Home » Archimedes archive » Acorn Computing » 1993 05 Mega Disk.adf » 93_05 » Miscellany/Speller/Dictionary

Miscellany/Speller/Dictionary

This website contains an archive of files for the Acorn Electron, BBC Micro, Acorn Archimedes, Commodore 16 and Commodore 64 computers, which Dominic Ford has rescued from his private collection of floppy disks and cassettes.

Some of these files were originally commercial releases in the 1980s and 1990s, but they are now widely available online. I assume that copyright over them is no longer being asserted. If you own the copyright and would like files to be removed, please contact me.

Tape/disk: Home » Archimedes archive » Acorn Computing » 1993 05 Mega Disk.adf » 93_05
Filename: Miscellany/Speller/Dictionary
Read OK:
File size: 522E bytes
Load address: 0000
Exec address: 0000
File contents
��aabandonabbreviationabbreviationsabilityableabnormalaboutaboveabscenceabsenceabsentabsoluteacceptsaccessaccessedaccessesaccessibleaccessingaccordingaccordinglyaccountaccountingaccumulatesachieveachievedacknowledgeacornacquiredacrossactactionactionsactivatedactualactuallyadaptationadaptedaddaddedaddingadditionaddressaddressedaddressesaddressingaddsadequateadjacentadjectiveadjustedadjustingadvanceadvancedadvancesadvantageadvantagesadvisableadvisesaffectaffirmativelyafterafterwardagainagainstagreedagreementaheadaidaliasalignedalignmentallallocateallocatedallocatesallocationallowallowedallowingallowsalmostalongalphabetalphabeticalphabeticalalreadyalsoalteralteredalternatealternativealternativelyalthoughalwaysamambiguityammountsamongamountananalogousanalogyandangleannouncedannouncesanotheransweransweredanswersantianyanyoneanythinganywayanywhereapartappearappearanceappearingappearsappendedappendixapplicationapplicationsappliedappliesapplyapplyingapproachappropriateappropriatelyaprilarbitraryarchimedesarchitecturearchivearchivedarchivesarchivingareareaargumentargumentsarisearithmeticarmaroundarrangearrangementarrangesarrayarraysarrivearrivesarrowsartificialasasideaskaskedaskingasksaspectaspectsassemblersassetassignassignedassignmentassignmentsassignsassociateassociatedassociatesassociationassociativeassociativityassumeassumedassumesassumingassumptionsassuredasteriskatattachedattemptattitudeattributeattributesaugustauthorautomaticautomaticallyavailableaverageavoidavoidedavoidingawayaxisYHbackbackgroundbackwardbackwardsbadbadlybalancingbarbarelybasebasedbasicbasicsbasisbebearbecausebecomebecomesbedbeenbeforebeganbeginbeginningbeginsbehavebehavedbehaviourbeingbelievebelievesbelowbeneathbesidesbestbetsbetterbetweenbeyondbigbiggerbinarybindbindingbirthbitbitsblackblankblanksblessingblockblocksboardsbodiesbodybookbootbothbottomboundariesboundaryboxbracebracesbracketsbranchbranchesbreakbreakingbriefbrokenbrownbrowsebufferbugbugsbuildbuiltbulletinburiedburybutbuttonbuttonsbuybybye�	calculationcalculatorcallcalledcallercallingcallscancancelcannotcapabilitiescapabilitycapablecarecarefulcarefullycarelesslycaretcasecasescastcastscatchcategoriescausecausescautioncavaliercaveatscellcellscelsiuscentigradecentralizedcentralizescentrecertaincertainlychainchancechangechangedchangeschangingchapterchapterscharactercharacteristicscharacterschargechargedchargescheckcheckedcheckingcheckschildchildrenchoicechoiceschoosechosenchunkchunkycirclecirclescirculatedcircumstancesclarifiesclarifyclarifyingclarityclassclassescleancleanestclearclearerclearlyclearsclickclickedclickingclockwisecloseclosedcloselyclosestclosingcodecodingcoercecoercedcoincollapsecollectcollectedcollectingcollectioncollectionscoloncolourcolumncombinationcombinationscombinecombinedcomecomescomfortablycomingcommacommandcommandscommascommentcommentscommoncommonlycommunicatecommunicatingcommunicationcommunicationscommunicativecompactcompanycomparativelycomparecomparedcomparescomparingcomparisoncomparisonscompatiblecompilationcompilecompiledcompilercompilerscomplementcomplementingcompletecompletelycompletenesscomplexitycomplicatedcomplicationcomponentscompoundcompresscompressedcompressioncomputationcomputationscomputecomputedcomputescomputingconcatenateconcatenatedconcatenatesconcealconcentrateconceptuallyconcernconcernedconcernsconciseconciselyconcisenessconcreteconditionconditionalconditionsconfidenceconfirmationconflictconfuseconfusedconnectedconnectionsconnectivesconnectsconnotesconsecutiveconsequenceconsiderconsiderableconsiderationsconsideredconsistconsistentconsistentlyconsistsconstantconstantsconstrainedconstructconstructionconstructionscontactedcontaincontainedcontainingcontainscontentcontentscontextcontextscontinuecontinuedcontinuescontinuouscontrastcontrolcontrolledcontrollingcontrolsconvenienceconvenientconvenientlyconventionconventionalconventionallyconventionsconversionconversionsconvertconvertedconverterconvertingconvertorconvertsconveycooperatingcoordinatecoordinatescopecopescopiedcopiescopycopyingcopyrightcorrectcorrectedcorrectlycorrespondcorrespondencecorrespondingcostcouldcountcountedcountercountingcountscoursecovercoveredcreatecreatedcreatescreatingcreationcriticalcrypticcurrentcurrentlycutscycle��datadatabasesdatedatesdaydaysdealdealingdealtdecemberdecideddecidesdecimaldecisiondecisionsdeclarationdeclarationsdeclaredeclareddeclaresdeclaringdecreaseddecreasingdecrementdecrementeddecrementingdecrementsdeepdeeplydefaultdefensivedeferdeferreddefinedefineddefinesdefiningdefinitiondefinitionsdegreedegreesdeletedeleteddeletesdeletingdelimitdeliversdependdependantdependingdependsderiveddescribedescribeddescribesdescribingdescriptiondescriptionsdesigndesigneddesirabledesireddeskdestinationdestroysdetaildetaileddetailsdetectdetecteddetectingdetectiondeterminedetermineddeterminesdevicesdiagnosticsdialoguedictionarydiddifferencedifferencesdifferentdiffersdigitdigitsdigressiondimensiondirectdirectiondirectlydirectoriesdirectorydisagreedisalloweddisappeardisappearingdisappearsdisasterdiscdiscardeddiscardsdisciplinedisclaimerdiscoverdiscovereddiscretiondiscriptivediscussdiscusseddiscussesdiscussiondisintegrationdiskdisorderdispensedisplaydisplayeddisplayingdisplaysdisposeddistancedistinctdistinctiondistinguishdistinguishabledistinguisheddistributeddistributiondisturbingdiversedividedivideddividerdividesdivisibledivisiondodocumentdocumentationdoesdogdogmaticdoingdomaindonationdonedoubledowndownloadingdraftdragdraggeddraggingdrawdrawingdrawndrivedroppeddroppingduedummyduringdynamic�Teachearlierearlyeasiereasiesteasilyeasingeasyechoechoesedgeediteditingeditoreffecteffectiveeffectivelyeffectsefficiencyefficientefficientlyefforteighteitherelaboratedelaborationelectronicelementelementseliminateeliminateseliminationelseelsewhereembeddedembeddingemphasizeemphasizedemphasizesemployeeemptyenableencapsulateencloseenclosedenclosingencounteredencountersencryptedendendsenhancementsenoughensureensuresensuringenterenteredenteringentersentireentirelyentitiesentriesentryenvelopeenvironmentsequalequalityequallyequalsequationequivalenceequivalentequivalentlyequivalentserasederrorerrorsescapeespeciallyessentialessentiallyevaluateevaluatedevaluatesevaluatingevaluationeveneventeventuallyevereveryeverythingeverywhereevidentlyexactlyexamineexaminedexampleexamplesexceedexceedsexceptexceptionexcessexchangeexchangedexchangesexcludingexclusiveexecutableexecuteexecutedexecutesexecutingexecutionexemplifiedexerciseexistexistenceexistentexistingexistsexitexitedexitingexitsexpandedexpandsexpansionexpectexpectedexpectsexpensiveexperiencedexperimentexplanationsexplicitexplicitlyexponentiationexpressexpressionexpressionsextendedextensibleextensionextensionsextensiveexternalexternallyextraextractedextremep+facesfacetsfacilitatefacilitiesfacilityfacingfactfactorfahrenheitfailsfairlyfallfallingfallsfalsefalsehoodfamiliarfamilyfansfarfashionfastfasterfastestfeaturefebruaryfedfeedfeelfetchfetchedfetchesfetchingfewfewerfiddlingfieldfieldsfilefilerfilesfilingfillfilledfillingfillsfinalfinallyfindfindingfindsfinishedfinitefirstfitfivefixedflagflagsflexibilityflexibleflipflippedfloatfloatingfloodflowfollowfollowedfollowingfollowsforforceforcedforcesforeverformformalformallyformatformatsformattedformerformsformulaforthfortunatelyforwardfoundfourfourthfoxfractionfractionalfragmentfraughtfreefreelyfrequentfrequentlyfreshfromfullfullyfunctionfunctionallyfunctionsfundamentalfuntionfurtherfurthermorefuture(Cgapgarbagegeneralgeneralitygeneralizationgeneralizationsgeneralizegenerallygenerategeneratedgeneratinggetgetsgettinggivegivengivesgivingglanceglobalgloballygogoesgoinggonegoodgraduallygrammaticalgrammaticallygraphicgraspgreatergroupgroupedgroupsgrowguaranteeguaranteedguaranteesguide09hadhalfhandhandedhandfulhandlehandleshandlinghandyhappenhappenshardharderhardwarehashashhashedhashinghastyhaveheheavilyheldhellohelphenhencehenceforthherehiddenhidehierarchyhighhigherhighesthighlightedholdholdingholdsholeshomehosthourglasshourshowhoweverhumanhurdle��iiconideaidealideallyidenticalidenticallyidentifiedidentifieridentifiersidiomidiomsidleifignoreignoredignoresillegalilluminatingillustrateillustratedillustrationimagineimmediateimmediatelyimplementimplementationimplementationsimplementedimplicationimplicationsimplicitimplicitlyimpliedimpliesimplyimportantimposedimpossibleimprovedimprovementimprovementsimprovingininaccessibleinadvertentinadvertentlyincludeincludedincludesincludinginclusioninclusiveincominginconsistentlyincreaseincreasedincreasesincreasingincrementincrementedincrementingincrementsindeedindentationindentedindentingindependantindependentindexindexingindicateindicatedindicatesindicatingindicationindirectlyindividualindividualsinequalityinferiorinfiniteinfinitelyinformationinherentlyinitialinitiallyinitiatedinnardsinnerinnocenceinputinsensitiveinsertedinsertioninsideinstallinstalledinstallsinstanceinstancesinsteadinstructionsinstructiveintegerintegersintegrationintelligentintelligentlyintendedintentinteractionsinterchangeinterestinterestinginterfacesinterfereinterleavedintermediateintermixedinternalinternallyinterpretinterpretationinterpretedinterpreterintervalinterveningintointroducedintroducesintroductioninverseinversioninvestigateinvestigatedinvisibleinvocationinvocationsinvokeinvokedinvolveinvolvedinvolvesinvolvingirrelevantisisolatedissueissuedissuesititemiterationitsitself"januaryjobjulyjumpedjunejustZkeepkeepingkeepskeptkeykeyboardkeywordkeywordskindkindsknowknowingknownknows\�labellabelledlabelslanguagelanguageslargelargelylargerlargestlastlastslaterlatterlawslazyleadleadingleadsleaplearnlearnedleastleaveleavesleavingledleeleftlegallegitimatelylengthlengthslessletletsletterletterslevellevelslexicographiclexicographicallyliabilitylibertieslibertylibrarieslibrarylicencelielieslifetimelikelikelylimelimitlimitationslimitedlimitslinelinearlineslistlistedlistinglistsliterallittleloadloadedloadersloadinglocallocatedlocationlogicallogicallylonglongerlongestlooklookedlookinglookslooploopslooselosslostlotlowlowerluckylumped�machinemachinesmademagazinesmagicmagnificationmagnifiedmagnifymailmainmainlymaintainmaintainedmaintainingmaintainsmajormajoritymakemakermakesmakingmanagedmanagementmanagingmandatorymanipulatemanipulatedmanipulatesmanipulatingmanipulationmanipulationsmannermanuallymanymapsmarchmarchedmarginmarkmarksmarvellousmaskmaskingmasksmasteredmatchmatchedmatchesmatchingmathematicalmattermattersmaximummaymemeanmeaningmeaningfulmeaningfullymeaninglessmeansmeantimemechanicalmechanicsmechanismmechanismsmediummeetmeetsmembermembersmemorymenmentionedmentioningmenumerelymeritmessmessagemetmethodmethodsmicromiddlemightmimicsmindmineminimalminimizedminimumminorminusmissingmisspeltmistakemisusemixedmixturemnemonicmodemodelmodestmodificationmodificationsmodifiedmodifymodifyingmodulemodulusmomentmonthmoralmoremostmostlymovemovedmovesmovingmuchmultimultiplemultiplicationmultipliedmultipliermultiplymustmymysteriously5znamenamednamesnamingnastynaturalnaturallynaturenearneatlynecessarilynecessaryneedneededneedsnegativeneithernestnestednestingnetnevernewnewcomersnextnicenicelynonodenodesnonenonsensenormalnormallynotnotablynotationnotationalnotenotednothingnoticenovembernownuisancenullnumbernumberingnumbersnumericnumericalnumericallynumerousK$oakobeyobjectobjectsobservationobserveobservedobtainobtainedobviousobviouslyoccupiesoccupyoccuroccurrenceoccurrencesoccursoctoberoddofoffofferoffersoffsetoftenokoldolderomitomittedommitedommittedononceoneonesonlyopenopenedopeningopensoperateoperatingoperationoperationsoperatoroperatorsoppositeoptionoptionaloptionallyororderorderedorderingordinaryorganizationorganizeoriginoriginaloriginallyotherothersotherwiseouroutouteroutlineoutputoutsideoveroverflowoverheadoverlapown��packpackagepackagespaddingpagepainpainstakinglypaintpairpairedpairsparallelparameterparametersparentparenthesesparenthesisparenthesizedpartparticipateparticularparticularlypartlypartspartypasspassedpassespassingpatternpatternspaymentpenpeopleperpercentpercentagepercolatedperfectlyperformperformanceperformedperformingperformsperhapsperilpermanencepermanentpermanentlypermissiblepermissionpermissivepermitpermitspermittedperniciouspersonpersonalphonephrasedphysicalpickpickingpiecepiecesplaceplacedplacesplacingplainpleasepleasesplentyplotplotsplottedpluspointpointedpointerpointerspointingpointspolishpolygonspoppedpoppingpopularportabilityportablepositionpositionedpositioningpositionspositivepossibilitypossiblepossiblypostfixpotentialpotentiallypowerpowerspracticalpracticeprecedeprecededprecedenceprecedesprecisepreciselyprecisionpreferpreferablepreferencespreferredprefixprefixedprefixesprefixingpremiumpreparedpresencepresentpresentedpresentspreservedpresspressedpressingpresumablypreventpreviouspreviouslypriceprimarilyprimitiveprincipleprintprintedprintingprintsprivacyprivateprobablyproblemproblemsprocedureproceduresproceedproceedingproceedsprocessprocessedprocessesprocessingprocessorproduceproducedproducesproductproductionprofitprogramprogrammerprogrammersprogrammingprogramsprogressprogressionprogressionsprohibitpromotedpromotesproneproperproperlypropertiesprotectprototypesprovideprovidedprovidesprovidingpublicpublicitypublisherpurelypurposepushpushedpushespushingputputsuquadraticallyqualifiersqualityquantitiesquantityquestionquestionsquickquicklyquitquitequotequotedquotes�kradiusraiserandomrangerarelyratherreachedreachingreadreadabilityreadablereaderreadersreadilyreadingreadsreadyrealrealitiesreallyrearrangerearrangedreasonreasonablereasonablyreasoningreasonsrecallreceivesrecentlyrecognizerecognizesrecommendrecompiledrecordrecordsrecoveryrectangularredefinedreducedredundantreferreferencereferencedreferencesreferingreferredrefersreflectreflectedreflectingreflectsregardlessregisterregistersregistrationregrettablyregularrelatedrelationalrelationsrelationshipreleasedreleasesrelevantreliesreligiouslyremainremainderremainsremarksrememberrememberingremoteremovesremovingrenamerepeatrepeatedrepeatedlyrepeatsrepetitionreplacereplacedreplacementreplacesreplacingreplyreportreportedreportingrepositionrepositioningrepositionsrepresentrepresentationrepresentativerepresentedrepresentingrepresentsrequestrequestsrequirerequiredrequirementrequirementsrequiresrequiringrequisitereservedresetresetsresideresolvedrespectivelyresponsibilityresponsiblerestrestrictedrestrictionsresultresultingresultsresumeresumesretainretrievedreturnreturnedreturningreturnsreversereversesreversingrevisitrewriterewritingrewrittenrightriskyrobustroomrootroundedroundingroutineroutinesrowrowsroyaltyrudimentaryrulerulesrunrunning	safesafelysafersafestsaidsalarysamesatisfactorysatisfiedsatisfysavesavedsavessavingsaysayingsaysscalescaledscalesscalingscanscannedscanningscansscientificscopescratchscreenscrollscrolledsearchsearchedsearchessearchingsecondsecondssectionsectionssecurityseeseemseemsseenselectselectedselectingselfsellsellingsemicolonsemicolonssendsendingsensesensiblesentseparateseparatedseparatelyseparatesseparatorseptembersequencesequencesseriesseriousseriouslyserveserversservesservicesetsetssettingsettingsseveralshallshapesharesharedshellshiftshiftedshiftingshiftsshoeshortshortershortlyshouldshowshowedshownshowsshrinkingshrinkssidesidessightsignsignalsignalssignedsignificantsignificantlysimilarsimilarlysimplesimplersimplestsimplicitysimplifysimplysimulatesimulationsimultaneouslysincesinglesitessituationsituationssixsizesizedsizesskipskippedslightlyslowsmallsmallersosocialsoftwaresoldsolutionsolutionssolvesolvedsomesomehowsomeonesomethingsometimessomewhatsomewheresoonsophisticatedsortsortedsortingsortssoundssourcespacespacessparinglysparkspecialspecializedspecificspecificallyspecificationspecifiedspecifiesspecifyspeedsspeltspitesplitspritespritessquaresquashedsqueezestackstagestagesstampedstandardstandsstartstartedstartingstartsstatestatedstatementstatementsstatesstaticstatusstealingstepstepsstickstickystillstingstopstoppedstopsstoragestorestoredstoresstoringstraightstraightforwardstraightforwardlystreamstrengthsstringstringsstrongstronglystructurestructuredstructuresstudiedstudystudyingstylestylessubsubjectsubroutinesubscriptsubscriptingsubscriptssubsequentsubsequentlysubstantiallysubstitutedsubstitutionsubstitutionssubtlesubtractsubtractedsubtractingsubtractionsubtractssuccessfullysuccessivesuchsuffersufficessufficientsuggestsuggestedsuggestionssuggestssuitablesumsummarizedsummarizessuperiorsupersedesuppliedsuppliessupplysupplyingsupportsupportingsupportssupposesuppressessuprisingsuprisinglysuresurroundsurroundedsustainedswapswappingswitchswitchedsymbolsymbolicsymbolssynonymsyntacticallysyntaxsystemsystematicsystems{ttabtabletablestabstagtaggedtaketakentakestakingtalktargettasktaskstastetechnicallytelltellstemperaturetemperaturestemplatetemplatestemporarilytemporarytentendtendancytendencytendstenthtenthstermterminalterminateterminatedterminatesterminatingterminationterminologytermstesttestedtestingteststexttextstextualthanthanksthatthetheirthemthemselvesthentherethereafterthereforethesetheythicknessthingthingsthinkthirdthisthosethoughthoughtthreethroughthroughoutthustietightlytimetimestinytitletotogethertokentootooktoptopictowardtracktraditionaltrailtrailingtransferstransformationstranslatingtreattreatedtreatstreetreestrickytrivialtroubletruetrulytruncatestruncationtruthtryturnturnsturtletwelvetwentytwicetwintwotypetypedtypestypicaltypicallytypifiedtypographically9�ultimateunbalancedunchangedundefinedunderunderneathunderstandundesiredunequivocallyunexpectedunfamiliarunfortunateunfortunatelyunfriendlyunhappyuninitiatedunionunionsunitunitsuniversallyunknownunlessunlikeunlikelyunluckyunnamedunnecessaryunpredictableunquotedunrelatedunsatisfactoryunsignedunspecifieduntilunusualunwantedunwiselyupupdatedupgradesuponupperupwardupwardsususageuseusedusefuluserusersusesusingusualusuallyutility�vacatedvalidvaluablevaluevaluesvariablevariablesvariationvariationsvariesvariousvaryvectorverifyversionversionsversusveryvexingviaviceviewerviewingviewsvisibleA�waitingwaitswalkwantwantedwantswarningwaswastedwaywayswewelcomewellwentwerewhatwhateverwhenwherewhetherwhichwhicheverwhilewhilstwhitewhowholewhosewhywidewidestwidthwillwindowwindowswipeswiredwiringwisewiserwisheswithwithinwithoutwonderwordwordsworkworkingworksworldworryworryingworstworthworthwhileworthywouldwritewriteablewritingwrittenwrongwrote,yearyearsyesyetyieldsyouyouryourselfzerozeroszooming
00000000  cb 00 00 00 aa 06 00 00  61 00 61 62 61 6e 64 6f  |........a.abando|
00000010  6e 00 61 62 62 72 65 76  69 61 74 69 6f 6e 00 61  |n.abbreviation.a|
00000020  62 62 72 65 76 69 61 74  69 6f 6e 73 00 61 62 69  |bbreviations.abi|
00000030  6c 69 74 79 00 61 62 6c  65 00 61 62 6e 6f 72 6d  |lity.able.abnorm|
00000040  61 6c 00 61 62 6f 75 74  00 61 62 6f 76 65 00 61  |al.about.above.a|
00000050  62 73 63 65 6e 63 65 00  61 62 73 65 6e 63 65 00  |bscence.absence.|
00000060  61 62 73 65 6e 74 00 61  62 73 6f 6c 75 74 65 00  |absent.absolute.|
00000070  61 63 63 65 70 74 73 00  61 63 63 65 73 73 00 61  |accepts.access.a|
00000080  63 63 65 73 73 65 64 00  61 63 63 65 73 73 65 73  |ccessed.accesses|
00000090  00 61 63 63 65 73 73 69  62 6c 65 00 61 63 63 65  |.accessible.acce|
000000a0  73 73 69 6e 67 00 61 63  63 6f 72 64 69 6e 67 00  |ssing.according.|
000000b0  61 63 63 6f 72 64 69 6e  67 6c 79 00 61 63 63 6f  |accordingly.acco|
000000c0  75 6e 74 00 61 63 63 6f  75 6e 74 69 6e 67 00 61  |unt.accounting.a|
000000d0  63 63 75 6d 75 6c 61 74  65 73 00 61 63 68 69 65  |ccumulates.achie|
000000e0  76 65 00 61 63 68 69 65  76 65 64 00 61 63 6b 6e  |ve.achieved.ackn|
000000f0  6f 77 6c 65 64 67 65 00  61 63 6f 72 6e 00 61 63  |owledge.acorn.ac|
00000100  71 75 69 72 65 64 00 61  63 72 6f 73 73 00 61 63  |quired.across.ac|
00000110  74 00 61 63 74 69 6f 6e  00 61 63 74 69 6f 6e 73  |t.action.actions|
00000120  00 61 63 74 69 76 61 74  65 64 00 61 63 74 75 61  |.activated.actua|
00000130  6c 00 61 63 74 75 61 6c  6c 79 00 61 64 61 70 74  |l.actually.adapt|
00000140  61 74 69 6f 6e 00 61 64  61 70 74 65 64 00 61 64  |ation.adapted.ad|
00000150  64 00 61 64 64 65 64 00  61 64 64 69 6e 67 00 61  |d.added.adding.a|
00000160  64 64 69 74 69 6f 6e 00  61 64 64 72 65 73 73 00  |ddition.address.|
00000170  61 64 64 72 65 73 73 65  64 00 61 64 64 72 65 73  |addressed.addres|
00000180  73 65 73 00 61 64 64 72  65 73 73 69 6e 67 00 61  |ses.addressing.a|
00000190  64 64 73 00 61 64 65 71  75 61 74 65 00 61 64 6a  |dds.adequate.adj|
000001a0  61 63 65 6e 74 00 61 64  6a 65 63 74 69 76 65 00  |acent.adjective.|
000001b0  61 64 6a 75 73 74 65 64  00 61 64 6a 75 73 74 69  |adjusted.adjusti|
000001c0  6e 67 00 61 64 76 61 6e  63 65 00 61 64 76 61 6e  |ng.advance.advan|
000001d0  63 65 64 00 61 64 76 61  6e 63 65 73 00 61 64 76  |ced.advances.adv|
000001e0  61 6e 74 61 67 65 00 61  64 76 61 6e 74 61 67 65  |antage.advantage|
000001f0  73 00 61 64 76 69 73 61  62 6c 65 00 61 64 76 69  |s.advisable.advi|
00000200  73 65 73 00 61 66 66 65  63 74 00 61 66 66 69 72  |ses.affect.affir|
00000210  6d 61 74 69 76 65 6c 79  00 61 66 74 65 72 00 61  |matively.after.a|
00000220  66 74 65 72 77 61 72 64  00 61 67 61 69 6e 00 61  |fterward.again.a|
00000230  67 61 69 6e 73 74 00 61  67 72 65 65 64 00 61 67  |gainst.agreed.ag|
00000240  72 65 65 6d 65 6e 74 00  61 68 65 61 64 00 61 69  |reement.ahead.ai|
00000250  64 00 61 6c 69 61 73 00  61 6c 69 67 6e 65 64 00  |d.alias.aligned.|
00000260  61 6c 69 67 6e 6d 65 6e  74 00 61 6c 6c 00 61 6c  |alignment.all.al|
00000270  6c 6f 63 61 74 65 00 61  6c 6c 6f 63 61 74 65 64  |locate.allocated|
00000280  00 61 6c 6c 6f 63 61 74  65 73 00 61 6c 6c 6f 63  |.allocates.alloc|
00000290  61 74 69 6f 6e 00 61 6c  6c 6f 77 00 61 6c 6c 6f  |ation.allow.allo|
000002a0  77 65 64 00 61 6c 6c 6f  77 69 6e 67 00 61 6c 6c  |wed.allowing.all|
000002b0  6f 77 73 00 61 6c 6d 6f  73 74 00 61 6c 6f 6e 67  |ows.almost.along|
000002c0  00 61 6c 70 68 61 62 65  74 00 61 6c 70 68 61 62  |.alphabet.alphab|
000002d0  65 74 69 63 00 61 6c 70  68 61 62 65 74 69 63 61  |etic.alphabetica|
000002e0  6c 00 61 6c 72 65 61 64  79 00 61 6c 73 6f 00 61  |l.already.also.a|
000002f0  6c 74 65 72 00 61 6c 74  65 72 65 64 00 61 6c 74  |lter.altered.alt|
00000300  65 72 6e 61 74 65 00 61  6c 74 65 72 6e 61 74 69  |ernate.alternati|
00000310  76 65 00 61 6c 74 65 72  6e 61 74 69 76 65 6c 79  |ve.alternatively|
00000320  00 61 6c 74 68 6f 75 67  68 00 61 6c 77 61 79 73  |.although.always|
00000330  00 61 6d 00 61 6d 62 69  67 75 69 74 79 00 61 6d  |.am.ambiguity.am|
00000340  6d 6f 75 6e 74 73 00 61  6d 6f 6e 67 00 61 6d 6f  |mounts.among.amo|
00000350  75 6e 74 00 61 6e 00 61  6e 61 6c 6f 67 6f 75 73  |unt.an.analogous|
00000360  00 61 6e 61 6c 6f 67 79  00 61 6e 64 00 61 6e 67  |.analogy.and.ang|
00000370  6c 65 00 61 6e 6e 6f 75  6e 63 65 64 00 61 6e 6e  |le.announced.ann|
00000380  6f 75 6e 63 65 73 00 61  6e 6f 74 68 65 72 00 61  |ounces.another.a|
00000390  6e 73 77 65 72 00 61 6e  73 77 65 72 65 64 00 61  |nswer.answered.a|
000003a0  6e 73 77 65 72 73 00 61  6e 74 69 00 61 6e 79 00  |nswers.anti.any.|
000003b0  61 6e 79 6f 6e 65 00 61  6e 79 74 68 69 6e 67 00  |anyone.anything.|
000003c0  61 6e 79 77 61 79 00 61  6e 79 77 68 65 72 65 00  |anyway.anywhere.|
000003d0  61 70 61 72 74 00 61 70  70 65 61 72 00 61 70 70  |apart.appear.app|
000003e0  65 61 72 61 6e 63 65 00  61 70 70 65 61 72 69 6e  |earance.appearin|
000003f0  67 00 61 70 70 65 61 72  73 00 61 70 70 65 6e 64  |g.appears.append|
00000400  65 64 00 61 70 70 65 6e  64 69 78 00 61 70 70 6c  |ed.appendix.appl|
00000410  69 63 61 74 69 6f 6e 00  61 70 70 6c 69 63 61 74  |ication.applicat|
00000420  69 6f 6e 73 00 61 70 70  6c 69 65 64 00 61 70 70  |ions.applied.app|
00000430  6c 69 65 73 00 61 70 70  6c 79 00 61 70 70 6c 79  |lies.apply.apply|
00000440  69 6e 67 00 61 70 70 72  6f 61 63 68 00 61 70 70  |ing.approach.app|
00000450  72 6f 70 72 69 61 74 65  00 61 70 70 72 6f 70 72  |ropriate.appropr|
00000460  69 61 74 65 6c 79 00 61  70 72 69 6c 00 61 72 62  |iately.april.arb|
00000470  69 74 72 61 72 79 00 61  72 63 68 69 6d 65 64 65  |itrary.archimede|
00000480  73 00 61 72 63 68 69 74  65 63 74 75 72 65 00 61  |s.architecture.a|
00000490  72 63 68 69 76 65 00 61  72 63 68 69 76 65 64 00  |rchive.archived.|
000004a0  61 72 63 68 69 76 65 73  00 61 72 63 68 69 76 69  |archives.archivi|
000004b0  6e 67 00 61 72 65 00 61  72 65 61 00 61 72 67 75  |ng.are.area.argu|
000004c0  6d 65 6e 74 00 61 72 67  75 6d 65 6e 74 73 00 61  |ment.arguments.a|
000004d0  72 69 73 65 00 61 72 69  74 68 6d 65 74 69 63 00  |rise.arithmetic.|
000004e0  61 72 6d 00 61 72 6f 75  6e 64 00 61 72 72 61 6e  |arm.around.arran|
000004f0  67 65 00 61 72 72 61 6e  67 65 6d 65 6e 74 00 61  |ge.arrangement.a|
00000500  72 72 61 6e 67 65 73 00  61 72 72 61 79 00 61 72  |rranges.array.ar|
00000510  72 61 79 73 00 61 72 72  69 76 65 00 61 72 72 69  |rays.arrive.arri|
00000520  76 65 73 00 61 72 72 6f  77 73 00 61 72 74 69 66  |ves.arrows.artif|
00000530  69 63 69 61 6c 00 61 73  00 61 73 69 64 65 00 61  |icial.as.aside.a|
00000540  73 6b 00 61 73 6b 65 64  00 61 73 6b 69 6e 67 00  |sk.asked.asking.|
00000550  61 73 6b 73 00 61 73 70  65 63 74 00 61 73 70 65  |asks.aspect.aspe|
00000560  63 74 73 00 61 73 73 65  6d 62 6c 65 72 73 00 61  |cts.assemblers.a|
00000570  73 73 65 74 00 61 73 73  69 67 6e 00 61 73 73 69  |sset.assign.assi|
00000580  67 6e 65 64 00 61 73 73  69 67 6e 6d 65 6e 74 00  |gned.assignment.|
00000590  61 73 73 69 67 6e 6d 65  6e 74 73 00 61 73 73 69  |assignments.assi|
000005a0  67 6e 73 00 61 73 73 6f  63 69 61 74 65 00 61 73  |gns.associate.as|
000005b0  73 6f 63 69 61 74 65 64  00 61 73 73 6f 63 69 61  |sociated.associa|
000005c0  74 65 73 00 61 73 73 6f  63 69 61 74 69 6f 6e 00  |tes.association.|
000005d0  61 73 73 6f 63 69 61 74  69 76 65 00 61 73 73 6f  |associative.asso|
000005e0  63 69 61 74 69 76 69 74  79 00 61 73 73 75 6d 65  |ciativity.assume|
000005f0  00 61 73 73 75 6d 65 64  00 61 73 73 75 6d 65 73  |.assumed.assumes|
00000600  00 61 73 73 75 6d 69 6e  67 00 61 73 73 75 6d 70  |.assuming.assump|
00000610  74 69 6f 6e 73 00 61 73  73 75 72 65 64 00 61 73  |tions.assured.as|
00000620  74 65 72 69 73 6b 00 61  74 00 61 74 74 61 63 68  |terisk.at.attach|
00000630  65 64 00 61 74 74 65 6d  70 74 00 61 74 74 69 74  |ed.attempt.attit|
00000640  75 64 65 00 61 74 74 72  69 62 75 74 65 00 61 74  |ude.attribute.at|
00000650  74 72 69 62 75 74 65 73  00 61 75 67 75 73 74 00  |tributes.august.|
00000660  61 75 74 68 6f 72 00 61  75 74 6f 6d 61 74 69 63  |author.automatic|
00000670  00 61 75 74 6f 6d 61 74  69 63 61 6c 6c 79 00 61  |.automatically.a|
00000680  76 61 69 6c 61 62 6c 65  00 61 76 65 72 61 67 65  |vailable.average|
00000690  00 61 76 6f 69 64 00 61  76 6f 69 64 65 64 00 61  |.avoid.avoided.a|
000006a0  76 6f 69 64 69 6e 67 00  61 77 61 79 00 61 78 69  |voiding.away.axi|
000006b0  73 00 59 00 00 00 48 02  00 00 62 61 63 6b 00 62  |s.Y...H...back.b|
000006c0  61 63 6b 67 72 6f 75 6e  64 00 62 61 63 6b 77 61  |ackground.backwa|
000006d0  72 64 00 62 61 63 6b 77  61 72 64 73 00 62 61 64  |rd.backwards.bad|
000006e0  00 62 61 64 6c 79 00 62  61 6c 61 6e 63 69 6e 67  |.badly.balancing|
000006f0  00 62 61 72 00 62 61 72  65 6c 79 00 62 61 73 65  |.bar.barely.base|
00000700  00 62 61 73 65 64 00 62  61 73 69 63 00 62 61 73  |.based.basic.bas|
00000710  69 63 73 00 62 61 73 69  73 00 62 65 00 62 65 61  |ics.basis.be.bea|
00000720  72 00 62 65 63 61 75 73  65 00 62 65 63 6f 6d 65  |r.because.become|
00000730  00 62 65 63 6f 6d 65 73  00 62 65 64 00 62 65 65  |.becomes.bed.bee|
00000740  6e 00 62 65 66 6f 72 65  00 62 65 67 61 6e 00 62  |n.before.began.b|
00000750  65 67 69 6e 00 62 65 67  69 6e 6e 69 6e 67 00 62  |egin.beginning.b|
00000760  65 67 69 6e 73 00 62 65  68 61 76 65 00 62 65 68  |egins.behave.beh|
00000770  61 76 65 64 00 62 65 68  61 76 69 6f 75 72 00 62  |aved.behaviour.b|
00000780  65 69 6e 67 00 62 65 6c  69 65 76 65 00 62 65 6c  |eing.believe.bel|
00000790  69 65 76 65 73 00 62 65  6c 6f 77 00 62 65 6e 65  |ieves.below.bene|
000007a0  61 74 68 00 62 65 73 69  64 65 73 00 62 65 73 74  |ath.besides.best|
000007b0  00 62 65 74 73 00 62 65  74 74 65 72 00 62 65 74  |.bets.better.bet|
000007c0  77 65 65 6e 00 62 65 79  6f 6e 64 00 62 69 67 00  |ween.beyond.big.|
000007d0  62 69 67 67 65 72 00 62  69 6e 61 72 79 00 62 69  |bigger.binary.bi|
000007e0  6e 64 00 62 69 6e 64 69  6e 67 00 62 69 72 74 68  |nd.binding.birth|
000007f0  00 62 69 74 00 62 69 74  73 00 62 6c 61 63 6b 00  |.bit.bits.black.|
00000800  62 6c 61 6e 6b 00 62 6c  61 6e 6b 73 00 62 6c 65  |blank.blanks.ble|
00000810  73 73 69 6e 67 00 62 6c  6f 63 6b 00 62 6c 6f 63  |ssing.block.bloc|
00000820  6b 73 00 62 6f 61 72 64  73 00 62 6f 64 69 65 73  |ks.boards.bodies|
00000830  00 62 6f 64 79 00 62 6f  6f 6b 00 62 6f 6f 74 00  |.body.book.boot.|
00000840  62 6f 74 68 00 62 6f 74  74 6f 6d 00 62 6f 75 6e  |both.bottom.boun|
00000850  64 61 72 69 65 73 00 62  6f 75 6e 64 61 72 79 00  |daries.boundary.|
00000860  62 6f 78 00 62 72 61 63  65 00 62 72 61 63 65 73  |box.brace.braces|
00000870  00 62 72 61 63 6b 65 74  73 00 62 72 61 6e 63 68  |.brackets.branch|
00000880  00 62 72 61 6e 63 68 65  73 00 62 72 65 61 6b 00  |.branches.break.|
00000890  62 72 65 61 6b 69 6e 67  00 62 72 69 65 66 00 62  |breaking.brief.b|
000008a0  72 6f 6b 65 6e 00 62 72  6f 77 6e 00 62 72 6f 77  |roken.brown.brow|
000008b0  73 65 00 62 75 66 66 65  72 00 62 75 67 00 62 75  |se.buffer.bug.bu|
000008c0  67 73 00 62 75 69 6c 64  00 62 75 69 6c 74 00 62  |gs.build.built.b|
000008d0  75 6c 6c 65 74 69 6e 00  62 75 72 69 65 64 00 62  |ulletin.buried.b|
000008e0  75 72 79 00 62 75 74 00  62 75 74 74 6f 6e 00 62  |ury.but.button.b|
000008f0  75 74 74 6f 6e 73 00 62  75 79 00 62 79 00 62 79  |uttons.buy.by.by|
00000900  65 00 0f 01 00 00 bf 09  00 00 63 61 6c 63 75 6c  |e.........calcul|
00000910  61 74 69 6f 6e 00 63 61  6c 63 75 6c 61 74 6f 72  |ation.calculator|
00000920  00 63 61 6c 6c 00 63 61  6c 6c 65 64 00 63 61 6c  |.call.called.cal|
00000930  6c 65 72 00 63 61 6c 6c  69 6e 67 00 63 61 6c 6c  |ler.calling.call|
00000940  73 00 63 61 6e 00 63 61  6e 63 65 6c 00 63 61 6e  |s.can.cancel.can|
00000950  6e 6f 74 00 63 61 70 61  62 69 6c 69 74 69 65 73  |not.capabilities|
00000960  00 63 61 70 61 62 69 6c  69 74 79 00 63 61 70 61  |.capability.capa|
00000970  62 6c 65 00 63 61 72 65  00 63 61 72 65 66 75 6c  |ble.care.careful|
00000980  00 63 61 72 65 66 75 6c  6c 79 00 63 61 72 65 6c  |.carefully.carel|
00000990  65 73 73 6c 79 00 63 61  72 65 74 00 63 61 73 65  |essly.caret.case|
000009a0  00 63 61 73 65 73 00 63  61 73 74 00 63 61 73 74  |.cases.cast.cast|
000009b0  73 00 63 61 74 63 68 00  63 61 74 65 67 6f 72 69  |s.catch.categori|
000009c0  65 73 00 63 61 75 73 65  00 63 61 75 73 65 73 00  |es.cause.causes.|
000009d0  63 61 75 74 69 6f 6e 00  63 61 76 61 6c 69 65 72  |caution.cavalier|
000009e0  00 63 61 76 65 61 74 73  00 63 65 6c 6c 00 63 65  |.caveats.cell.ce|
000009f0  6c 6c 73 00 63 65 6c 73  69 75 73 00 63 65 6e 74  |lls.celsius.cent|
00000a00  69 67 72 61 64 65 00 63  65 6e 74 72 61 6c 69 7a  |igrade.centraliz|
00000a10  65 64 00 63 65 6e 74 72  61 6c 69 7a 65 73 00 63  |ed.centralizes.c|
00000a20  65 6e 74 72 65 00 63 65  72 74 61 69 6e 00 63 65  |entre.certain.ce|
00000a30  72 74 61 69 6e 6c 79 00  63 68 61 69 6e 00 63 68  |rtainly.chain.ch|
00000a40  61 6e 63 65 00 63 68 61  6e 67 65 00 63 68 61 6e  |ance.change.chan|
00000a50  67 65 64 00 63 68 61 6e  67 65 73 00 63 68 61 6e  |ged.changes.chan|
00000a60  67 69 6e 67 00 63 68 61  70 74 65 72 00 63 68 61  |ging.chapter.cha|
00000a70  70 74 65 72 73 00 63 68  61 72 61 63 74 65 72 00  |pters.character.|
00000a80  63 68 61 72 61 63 74 65  72 69 73 74 69 63 73 00  |characteristics.|
00000a90  63 68 61 72 61 63 74 65  72 73 00 63 68 61 72 67  |characters.charg|
00000aa0  65 00 63 68 61 72 67 65  64 00 63 68 61 72 67 65  |e.charged.charge|
00000ab0  73 00 63 68 65 63 6b 00  63 68 65 63 6b 65 64 00  |s.check.checked.|
00000ac0  63 68 65 63 6b 69 6e 67  00 63 68 65 63 6b 73 00  |checking.checks.|
00000ad0  63 68 69 6c 64 00 63 68  69 6c 64 72 65 6e 00 63  |child.children.c|
00000ae0  68 6f 69 63 65 00 63 68  6f 69 63 65 73 00 63 68  |hoice.choices.ch|
00000af0  6f 6f 73 65 00 63 68 6f  73 65 6e 00 63 68 75 6e  |oose.chosen.chun|
00000b00  6b 00 63 68 75 6e 6b 79  00 63 69 72 63 6c 65 00  |k.chunky.circle.|
00000b10  63 69 72 63 6c 65 73 00  63 69 72 63 75 6c 61 74  |circles.circulat|
00000b20  65 64 00 63 69 72 63 75  6d 73 74 61 6e 63 65 73  |ed.circumstances|
00000b30  00 63 6c 61 72 69 66 69  65 73 00 63 6c 61 72 69  |.clarifies.clari|
00000b40  66 79 00 63 6c 61 72 69  66 79 69 6e 67 00 63 6c  |fy.clarifying.cl|
00000b50  61 72 69 74 79 00 63 6c  61 73 73 00 63 6c 61 73  |arity.class.clas|
00000b60  73 65 73 00 63 6c 65 61  6e 00 63 6c 65 61 6e 65  |ses.clean.cleane|
00000b70  73 74 00 63 6c 65 61 72  00 63 6c 65 61 72 65 72  |st.clear.clearer|
00000b80  00 63 6c 65 61 72 6c 79  00 63 6c 65 61 72 73 00  |.clearly.clears.|
00000b90  63 6c 69 63 6b 00 63 6c  69 63 6b 65 64 00 63 6c  |click.clicked.cl|
00000ba0  69 63 6b 69 6e 67 00 63  6c 6f 63 6b 77 69 73 65  |icking.clockwise|
00000bb0  00 63 6c 6f 73 65 00 63  6c 6f 73 65 64 00 63 6c  |.close.closed.cl|
00000bc0  6f 73 65 6c 79 00 63 6c  6f 73 65 73 74 00 63 6c  |osely.closest.cl|
00000bd0  6f 73 69 6e 67 00 63 6f  64 65 00 63 6f 64 69 6e  |osing.code.codin|
00000be0  67 00 63 6f 65 72 63 65  00 63 6f 65 72 63 65 64  |g.coerce.coerced|
00000bf0  00 63 6f 69 6e 00 63 6f  6c 6c 61 70 73 65 00 63  |.coin.collapse.c|
00000c00  6f 6c 6c 65 63 74 00 63  6f 6c 6c 65 63 74 65 64  |ollect.collected|
00000c10  00 63 6f 6c 6c 65 63 74  69 6e 67 00 63 6f 6c 6c  |.collecting.coll|
00000c20  65 63 74 69 6f 6e 00 63  6f 6c 6c 65 63 74 69 6f  |ection.collectio|
00000c30  6e 73 00 63 6f 6c 6f 6e  00 63 6f 6c 6f 75 72 00  |ns.colon.colour.|
00000c40  63 6f 6c 75 6d 6e 00 63  6f 6d 62 69 6e 61 74 69  |column.combinati|
00000c50  6f 6e 00 63 6f 6d 62 69  6e 61 74 69 6f 6e 73 00  |on.combinations.|
00000c60  63 6f 6d 62 69 6e 65 00  63 6f 6d 62 69 6e 65 64  |combine.combined|
00000c70  00 63 6f 6d 65 00 63 6f  6d 65 73 00 63 6f 6d 66  |.come.comes.comf|
00000c80  6f 72 74 61 62 6c 79 00  63 6f 6d 69 6e 67 00 63  |ortably.coming.c|
00000c90  6f 6d 6d 61 00 63 6f 6d  6d 61 6e 64 00 63 6f 6d  |omma.command.com|
00000ca0  6d 61 6e 64 73 00 63 6f  6d 6d 61 73 00 63 6f 6d  |mands.commas.com|
00000cb0  6d 65 6e 74 00 63 6f 6d  6d 65 6e 74 73 00 63 6f  |ment.comments.co|
00000cc0  6d 6d 6f 6e 00 63 6f 6d  6d 6f 6e 6c 79 00 63 6f  |mmon.commonly.co|
00000cd0  6d 6d 75 6e 69 63 61 74  65 00 63 6f 6d 6d 75 6e  |mmunicate.commun|
00000ce0  69 63 61 74 69 6e 67 00  63 6f 6d 6d 75 6e 69 63  |icating.communic|
00000cf0  61 74 69 6f 6e 00 63 6f  6d 6d 75 6e 69 63 61 74  |ation.communicat|
00000d00  69 6f 6e 73 00 63 6f 6d  6d 75 6e 69 63 61 74 69  |ions.communicati|
00000d10  76 65 00 63 6f 6d 70 61  63 74 00 63 6f 6d 70 61  |ve.compact.compa|
00000d20  6e 79 00 63 6f 6d 70 61  72 61 74 69 76 65 6c 79  |ny.comparatively|
00000d30  00 63 6f 6d 70 61 72 65  00 63 6f 6d 70 61 72 65  |.compare.compare|
00000d40  64 00 63 6f 6d 70 61 72  65 73 00 63 6f 6d 70 61  |d.compares.compa|
00000d50  72 69 6e 67 00 63 6f 6d  70 61 72 69 73 6f 6e 00  |ring.comparison.|
00000d60  63 6f 6d 70 61 72 69 73  6f 6e 73 00 63 6f 6d 70  |comparisons.comp|
00000d70  61 74 69 62 6c 65 00 63  6f 6d 70 69 6c 61 74 69  |atible.compilati|
00000d80  6f 6e 00 63 6f 6d 70 69  6c 65 00 63 6f 6d 70 69  |on.compile.compi|
00000d90  6c 65 64 00 63 6f 6d 70  69 6c 65 72 00 63 6f 6d  |led.compiler.com|
00000da0  70 69 6c 65 72 73 00 63  6f 6d 70 6c 65 6d 65 6e  |pilers.complemen|
00000db0  74 00 63 6f 6d 70 6c 65  6d 65 6e 74 69 6e 67 00  |t.complementing.|
00000dc0  63 6f 6d 70 6c 65 74 65  00 63 6f 6d 70 6c 65 74  |complete.complet|
00000dd0  65 6c 79 00 63 6f 6d 70  6c 65 74 65 6e 65 73 73  |ely.completeness|
00000de0  00 63 6f 6d 70 6c 65 78  69 74 79 00 63 6f 6d 70  |.complexity.comp|
00000df0  6c 69 63 61 74 65 64 00  63 6f 6d 70 6c 69 63 61  |licated.complica|
00000e00  74 69 6f 6e 00 63 6f 6d  70 6f 6e 65 6e 74 73 00  |tion.components.|
00000e10  63 6f 6d 70 6f 75 6e 64  00 63 6f 6d 70 72 65 73  |compound.compres|
00000e20  73 00 63 6f 6d 70 72 65  73 73 65 64 00 63 6f 6d  |s.compressed.com|
00000e30  70 72 65 73 73 69 6f 6e  00 63 6f 6d 70 75 74 61  |pression.computa|
00000e40  74 69 6f 6e 00 63 6f 6d  70 75 74 61 74 69 6f 6e  |tion.computation|
00000e50  73 00 63 6f 6d 70 75 74  65 00 63 6f 6d 70 75 74  |s.compute.comput|
00000e60  65 64 00 63 6f 6d 70 75  74 65 73 00 63 6f 6d 70  |ed.computes.comp|
00000e70  75 74 69 6e 67 00 63 6f  6e 63 61 74 65 6e 61 74  |uting.concatenat|
00000e80  65 00 63 6f 6e 63 61 74  65 6e 61 74 65 64 00 63  |e.concatenated.c|
00000e90  6f 6e 63 61 74 65 6e 61  74 65 73 00 63 6f 6e 63  |oncatenates.conc|
00000ea0  65 61 6c 00 63 6f 6e 63  65 6e 74 72 61 74 65 00  |eal.concentrate.|
00000eb0  63 6f 6e 63 65 70 74 75  61 6c 6c 79 00 63 6f 6e  |conceptually.con|
00000ec0  63 65 72 6e 00 63 6f 6e  63 65 72 6e 65 64 00 63  |cern.concerned.c|
00000ed0  6f 6e 63 65 72 6e 73 00  63 6f 6e 63 69 73 65 00  |oncerns.concise.|
00000ee0  63 6f 6e 63 69 73 65 6c  79 00 63 6f 6e 63 69 73  |concisely.concis|
00000ef0  65 6e 65 73 73 00 63 6f  6e 63 72 65 74 65 00 63  |eness.concrete.c|
00000f00  6f 6e 64 69 74 69 6f 6e  00 63 6f 6e 64 69 74 69  |ondition.conditi|
00000f10  6f 6e 61 6c 00 63 6f 6e  64 69 74 69 6f 6e 73 00  |onal.conditions.|
00000f20  63 6f 6e 66 69 64 65 6e  63 65 00 63 6f 6e 66 69  |confidence.confi|
00000f30  72 6d 61 74 69 6f 6e 00  63 6f 6e 66 6c 69 63 74  |rmation.conflict|
00000f40  00 63 6f 6e 66 75 73 65  00 63 6f 6e 66 75 73 65  |.confuse.confuse|
00000f50  64 00 63 6f 6e 6e 65 63  74 65 64 00 63 6f 6e 6e  |d.connected.conn|
00000f60  65 63 74 69 6f 6e 73 00  63 6f 6e 6e 65 63 74 69  |ections.connecti|
00000f70  76 65 73 00 63 6f 6e 6e  65 63 74 73 00 63 6f 6e  |ves.connects.con|
00000f80  6e 6f 74 65 73 00 63 6f  6e 73 65 63 75 74 69 76  |notes.consecutiv|
00000f90  65 00 63 6f 6e 73 65 71  75 65 6e 63 65 00 63 6f  |e.consequence.co|
00000fa0  6e 73 69 64 65 72 00 63  6f 6e 73 69 64 65 72 61  |nsider.considera|
00000fb0  62 6c 65 00 63 6f 6e 73  69 64 65 72 61 74 69 6f  |ble.consideratio|
00000fc0  6e 73 00 63 6f 6e 73 69  64 65 72 65 64 00 63 6f  |ns.considered.co|
00000fd0  6e 73 69 73 74 00 63 6f  6e 73 69 73 74 65 6e 74  |nsist.consistent|
00000fe0  00 63 6f 6e 73 69 73 74  65 6e 74 6c 79 00 63 6f  |.consistently.co|
00000ff0  6e 73 69 73 74 73 00 63  6f 6e 73 74 61 6e 74 00  |nsists.constant.|
00001000  63 6f 6e 73 74 61 6e 74  73 00 63 6f 6e 73 74 72  |constants.constr|
00001010  61 69 6e 65 64 00 63 6f  6e 73 74 72 75 63 74 00  |ained.construct.|
00001020  63 6f 6e 73 74 72 75 63  74 69 6f 6e 00 63 6f 6e  |construction.con|
00001030  73 74 72 75 63 74 69 6f  6e 73 00 63 6f 6e 74 61  |structions.conta|
00001040  63 74 65 64 00 63 6f 6e  74 61 69 6e 00 63 6f 6e  |cted.contain.con|
00001050  74 61 69 6e 65 64 00 63  6f 6e 74 61 69 6e 69 6e  |tained.containin|
00001060  67 00 63 6f 6e 74 61 69  6e 73 00 63 6f 6e 74 65  |g.contains.conte|
00001070  6e 74 00 63 6f 6e 74 65  6e 74 73 00 63 6f 6e 74  |nt.contents.cont|
00001080  65 78 74 00 63 6f 6e 74  65 78 74 73 00 63 6f 6e  |ext.contexts.con|
00001090  74 69 6e 75 65 00 63 6f  6e 74 69 6e 75 65 64 00  |tinue.continued.|
000010a0  63 6f 6e 74 69 6e 75 65  73 00 63 6f 6e 74 69 6e  |continues.contin|
000010b0  75 6f 75 73 00 63 6f 6e  74 72 61 73 74 00 63 6f  |uous.contrast.co|
000010c0  6e 74 72 6f 6c 00 63 6f  6e 74 72 6f 6c 6c 65 64  |ntrol.controlled|
000010d0  00 63 6f 6e 74 72 6f 6c  6c 69 6e 67 00 63 6f 6e  |.controlling.con|
000010e0  74 72 6f 6c 73 00 63 6f  6e 76 65 6e 69 65 6e 63  |trols.convenienc|
000010f0  65 00 63 6f 6e 76 65 6e  69 65 6e 74 00 63 6f 6e  |e.convenient.con|
00001100  76 65 6e 69 65 6e 74 6c  79 00 63 6f 6e 76 65 6e  |veniently.conven|
00001110  74 69 6f 6e 00 63 6f 6e  76 65 6e 74 69 6f 6e 61  |tion.conventiona|
00001120  6c 00 63 6f 6e 76 65 6e  74 69 6f 6e 61 6c 6c 79  |l.conventionally|
00001130  00 63 6f 6e 76 65 6e 74  69 6f 6e 73 00 63 6f 6e  |.conventions.con|
00001140  76 65 72 73 69 6f 6e 00  63 6f 6e 76 65 72 73 69  |version.conversi|
00001150  6f 6e 73 00 63 6f 6e 76  65 72 74 00 63 6f 6e 76  |ons.convert.conv|
00001160  65 72 74 65 64 00 63 6f  6e 76 65 72 74 65 72 00  |erted.converter.|
00001170  63 6f 6e 76 65 72 74 69  6e 67 00 63 6f 6e 76 65  |converting.conve|
00001180  72 74 6f 72 00 63 6f 6e  76 65 72 74 73 00 63 6f  |rtor.converts.co|
00001190  6e 76 65 79 00 63 6f 6f  70 65 72 61 74 69 6e 67  |nvey.cooperating|
000011a0  00 63 6f 6f 72 64 69 6e  61 74 65 00 63 6f 6f 72  |.coordinate.coor|
000011b0  64 69 6e 61 74 65 73 00  63 6f 70 65 00 63 6f 70  |dinates.cope.cop|
000011c0  65 73 00 63 6f 70 69 65  64 00 63 6f 70 69 65 73  |es.copied.copies|
000011d0  00 63 6f 70 79 00 63 6f  70 79 69 6e 67 00 63 6f  |.copy.copying.co|
000011e0  70 79 72 69 67 68 74 00  63 6f 72 72 65 63 74 00  |pyright.correct.|
000011f0  63 6f 72 72 65 63 74 65  64 00 63 6f 72 72 65 63  |corrected.correc|
00001200  74 6c 79 00 63 6f 72 72  65 73 70 6f 6e 64 00 63  |tly.correspond.c|
00001210  6f 72 72 65 73 70 6f 6e  64 65 6e 63 65 00 63 6f  |orrespondence.co|
00001220  72 72 65 73 70 6f 6e 64  69 6e 67 00 63 6f 73 74  |rresponding.cost|
00001230  00 63 6f 75 6c 64 00 63  6f 75 6e 74 00 63 6f 75  |.could.count.cou|
00001240  6e 74 65 64 00 63 6f 75  6e 74 65 72 00 63 6f 75  |nted.counter.cou|
00001250  6e 74 69 6e 67 00 63 6f  75 6e 74 73 00 63 6f 75  |nting.counts.cou|
00001260  72 73 65 00 63 6f 76 65  72 00 63 6f 76 65 72 65  |rse.cover.covere|
00001270  64 00 63 72 65 61 74 65  00 63 72 65 61 74 65 64  |d.create.created|
00001280  00 63 72 65 61 74 65 73  00 63 72 65 61 74 69 6e  |.creates.creatin|
00001290  67 00 63 72 65 61 74 69  6f 6e 00 63 72 69 74 69  |g.creation.criti|
000012a0  63 61 6c 00 63 72 79 70  74 69 63 00 63 75 72 72  |cal.cryptic.curr|
000012b0  65 6e 74 00 63 75 72 72  65 6e 74 6c 79 00 63 75  |ent.currently.cu|
000012c0  74 73 00 63 79 63 6c 65  00 a4 00 00 00 b1 05 00  |ts.cycle........|
000012d0  00 64 61 74 61 00 64 61  74 61 62 61 73 65 73 00  |.data.databases.|
000012e0  64 61 74 65 00 64 61 74  65 73 00 64 61 79 00 64  |date.dates.day.d|
000012f0  61 79 73 00 64 65 61 6c  00 64 65 61 6c 69 6e 67  |ays.deal.dealing|
00001300  00 64 65 61 6c 74 00 64  65 63 65 6d 62 65 72 00  |.dealt.december.|
00001310  64 65 63 69 64 65 64 00  64 65 63 69 64 65 73 00  |decided.decides.|
00001320  64 65 63 69 6d 61 6c 00  64 65 63 69 73 69 6f 6e  |decimal.decision|
00001330  00 64 65 63 69 73 69 6f  6e 73 00 64 65 63 6c 61  |.decisions.decla|
00001340  72 61 74 69 6f 6e 00 64  65 63 6c 61 72 61 74 69  |ration.declarati|
00001350  6f 6e 73 00 64 65 63 6c  61 72 65 00 64 65 63 6c  |ons.declare.decl|
00001360  61 72 65 64 00 64 65 63  6c 61 72 65 73 00 64 65  |ared.declares.de|
00001370  63 6c 61 72 69 6e 67 00  64 65 63 72 65 61 73 65  |claring.decrease|
00001380  64 00 64 65 63 72 65 61  73 69 6e 67 00 64 65 63  |d.decreasing.dec|
00001390  72 65 6d 65 6e 74 00 64  65 63 72 65 6d 65 6e 74  |rement.decrement|
000013a0  65 64 00 64 65 63 72 65  6d 65 6e 74 69 6e 67 00  |ed.decrementing.|
000013b0  64 65 63 72 65 6d 65 6e  74 73 00 64 65 65 70 00  |decrements.deep.|
000013c0  64 65 65 70 6c 79 00 64  65 66 61 75 6c 74 00 64  |deeply.default.d|
000013d0  65 66 65 6e 73 69 76 65  00 64 65 66 65 72 00 64  |efensive.defer.d|
000013e0  65 66 65 72 72 65 64 00  64 65 66 69 6e 65 00 64  |eferred.define.d|
000013f0  65 66 69 6e 65 64 00 64  65 66 69 6e 65 73 00 64  |efined.defines.d|
00001400  65 66 69 6e 69 6e 67 00  64 65 66 69 6e 69 74 69  |efining.definiti|
00001410  6f 6e 00 64 65 66 69 6e  69 74 69 6f 6e 73 00 64  |on.definitions.d|
00001420  65 67 72 65 65 00 64 65  67 72 65 65 73 00 64 65  |egree.degrees.de|
00001430  6c 65 74 65 00 64 65 6c  65 74 65 64 00 64 65 6c  |lete.deleted.del|
00001440  65 74 65 73 00 64 65 6c  65 74 69 6e 67 00 64 65  |etes.deleting.de|
00001450  6c 69 6d 69 74 00 64 65  6c 69 76 65 72 73 00 64  |limit.delivers.d|
00001460  65 70 65 6e 64 00 64 65  70 65 6e 64 61 6e 74 00  |epend.dependant.|
00001470  64 65 70 65 6e 64 69 6e  67 00 64 65 70 65 6e 64  |depending.depend|
00001480  73 00 64 65 72 69 76 65  64 00 64 65 73 63 72 69  |s.derived.descri|
00001490  62 65 00 64 65 73 63 72  69 62 65 64 00 64 65 73  |be.described.des|
000014a0  63 72 69 62 65 73 00 64  65 73 63 72 69 62 69 6e  |cribes.describin|
000014b0  67 00 64 65 73 63 72 69  70 74 69 6f 6e 00 64 65  |g.description.de|
000014c0  73 63 72 69 70 74 69 6f  6e 73 00 64 65 73 69 67  |scriptions.desig|
000014d0  6e 00 64 65 73 69 67 6e  65 64 00 64 65 73 69 72  |n.designed.desir|
000014e0  61 62 6c 65 00 64 65 73  69 72 65 64 00 64 65 73  |able.desired.des|
000014f0  6b 00 64 65 73 74 69 6e  61 74 69 6f 6e 00 64 65  |k.destination.de|
00001500  73 74 72 6f 79 73 00 64  65 74 61 69 6c 00 64 65  |stroys.detail.de|
00001510  74 61 69 6c 65 64 00 64  65 74 61 69 6c 73 00 64  |tailed.details.d|
00001520  65 74 65 63 74 00 64 65  74 65 63 74 65 64 00 64  |etect.detected.d|
00001530  65 74 65 63 74 69 6e 67  00 64 65 74 65 63 74 69  |etecting.detecti|
00001540  6f 6e 00 64 65 74 65 72  6d 69 6e 65 00 64 65 74  |on.determine.det|
00001550  65 72 6d 69 6e 65 64 00  64 65 74 65 72 6d 69 6e  |ermined.determin|
00001560  65 73 00 64 65 76 69 63  65 73 00 64 69 61 67 6e  |es.devices.diagn|
00001570  6f 73 74 69 63 73 00 64  69 61 6c 6f 67 75 65 00  |ostics.dialogue.|
00001580  64 69 63 74 69 6f 6e 61  72 79 00 64 69 64 00 64  |dictionary.did.d|
00001590  69 66 66 65 72 65 6e 63  65 00 64 69 66 66 65 72  |ifference.differ|
000015a0  65 6e 63 65 73 00 64 69  66 66 65 72 65 6e 74 00  |ences.different.|
000015b0  64 69 66 66 65 72 73 00  64 69 67 69 74 00 64 69  |differs.digit.di|
000015c0  67 69 74 73 00 64 69 67  72 65 73 73 69 6f 6e 00  |gits.digression.|
000015d0  64 69 6d 65 6e 73 69 6f  6e 00 64 69 72 65 63 74  |dimension.direct|
000015e0  00 64 69 72 65 63 74 69  6f 6e 00 64 69 72 65 63  |.direction.direc|
000015f0  74 6c 79 00 64 69 72 65  63 74 6f 72 69 65 73 00  |tly.directories.|
00001600  64 69 72 65 63 74 6f 72  79 00 64 69 73 61 67 72  |directory.disagr|
00001610  65 65 00 64 69 73 61 6c  6c 6f 77 65 64 00 64 69  |ee.disallowed.di|
00001620  73 61 70 70 65 61 72 00  64 69 73 61 70 70 65 61  |sappear.disappea|
00001630  72 69 6e 67 00 64 69 73  61 70 70 65 61 72 73 00  |ring.disappears.|
00001640  64 69 73 61 73 74 65 72  00 64 69 73 63 00 64 69  |disaster.disc.di|
00001650  73 63 61 72 64 65 64 00  64 69 73 63 61 72 64 73  |scarded.discards|
00001660  00 64 69 73 63 69 70 6c  69 6e 65 00 64 69 73 63  |.discipline.disc|
00001670  6c 61 69 6d 65 72 00 64  69 73 63 6f 76 65 72 00  |laimer.discover.|
00001680  64 69 73 63 6f 76 65 72  65 64 00 64 69 73 63 72  |discovered.discr|
00001690  65 74 69 6f 6e 00 64 69  73 63 72 69 70 74 69 76  |etion.discriptiv|
000016a0  65 00 64 69 73 63 75 73  73 00 64 69 73 63 75 73  |e.discuss.discus|
000016b0  73 65 64 00 64 69 73 63  75 73 73 65 73 00 64 69  |sed.discusses.di|
000016c0  73 63 75 73 73 69 6f 6e  00 64 69 73 69 6e 74 65  |scussion.disinte|
000016d0  67 72 61 74 69 6f 6e 00  64 69 73 6b 00 64 69 73  |gration.disk.dis|
000016e0  6f 72 64 65 72 00 64 69  73 70 65 6e 73 65 00 64  |order.dispense.d|
000016f0  69 73 70 6c 61 79 00 64  69 73 70 6c 61 79 65 64  |isplay.displayed|
00001700  00 64 69 73 70 6c 61 79  69 6e 67 00 64 69 73 70  |.displaying.disp|
00001710  6c 61 79 73 00 64 69 73  70 6f 73 65 64 00 64 69  |lays.disposed.di|
00001720  73 74 61 6e 63 65 00 64  69 73 74 69 6e 63 74 00  |stance.distinct.|
00001730  64 69 73 74 69 6e 63 74  69 6f 6e 00 64 69 73 74  |distinction.dist|
00001740  69 6e 67 75 69 73 68 00  64 69 73 74 69 6e 67 75  |inguish.distingu|
00001750  69 73 68 61 62 6c 65 00  64 69 73 74 69 6e 67 75  |ishable.distingu|
00001760  69 73 68 65 64 00 64 69  73 74 72 69 62 75 74 65  |ished.distribute|
00001770  64 00 64 69 73 74 72 69  62 75 74 69 6f 6e 00 64  |d.distribution.d|
00001780  69 73 74 75 72 62 69 6e  67 00 64 69 76 65 72 73  |isturbing.divers|
00001790  65 00 64 69 76 69 64 65  00 64 69 76 69 64 65 64  |e.divide.divided|
000017a0  00 64 69 76 69 64 65 72  00 64 69 76 69 64 65 73  |.divider.divides|
000017b0  00 64 69 76 69 73 69 62  6c 65 00 64 69 76 69 73  |.divisible.divis|
000017c0  69 6f 6e 00 64 6f 00 64  6f 63 75 6d 65 6e 74 00  |ion.do.document.|
000017d0  64 6f 63 75 6d 65 6e 74  61 74 69 6f 6e 00 64 6f  |documentation.do|
000017e0  65 73 00 64 6f 67 00 64  6f 67 6d 61 74 69 63 00  |es.dog.dogmatic.|
000017f0  64 6f 69 6e 67 00 64 6f  6d 61 69 6e 00 64 6f 6e  |doing.domain.don|
00001800  61 74 69 6f 6e 00 64 6f  6e 65 00 64 6f 75 62 6c  |ation.done.doubl|
00001810  65 00 64 6f 77 6e 00 64  6f 77 6e 6c 6f 61 64 69  |e.down.downloadi|
00001820  6e 67 00 64 72 61 66 74  00 64 72 61 67 00 64 72  |ng.draft.drag.dr|
00001830  61 67 67 65 64 00 64 72  61 67 67 69 6e 67 00 64  |agged.dragging.d|
00001840  72 61 77 00 64 72 61 77  69 6e 67 00 64 72 61 77  |raw.drawing.draw|
00001850  6e 00 64 72 69 76 65 00  64 72 6f 70 70 65 64 00  |n.drive.dropped.|
00001860  64 72 6f 70 70 69 6e 67  00 64 75 65 00 64 75 6d  |dropping.due.dum|
00001870  6d 79 00 64 75 72 69 6e  67 00 64 79 6e 61 6d 69  |my.during.dynami|
00001880  63 00 9a 00 00 00 54 05  00 00 65 61 63 68 00 65  |c.....T...each.e|
00001890  61 72 6c 69 65 72 00 65  61 72 6c 79 00 65 61 73  |arlier.early.eas|
000018a0  69 65 72 00 65 61 73 69  65 73 74 00 65 61 73 69  |ier.easiest.easi|
000018b0  6c 79 00 65 61 73 69 6e  67 00 65 61 73 79 00 65  |ly.easing.easy.e|
000018c0  63 68 6f 00 65 63 68 6f  65 73 00 65 64 67 65 00  |cho.echoes.edge.|
000018d0  65 64 69 74 00 65 64 69  74 69 6e 67 00 65 64 69  |edit.editing.edi|
000018e0  74 6f 72 00 65 66 66 65  63 74 00 65 66 66 65 63  |tor.effect.effec|
000018f0  74 69 76 65 00 65 66 66  65 63 74 69 76 65 6c 79  |tive.effectively|
00001900  00 65 66 66 65 63 74 73  00 65 66 66 69 63 69 65  |.effects.efficie|
00001910  6e 63 79 00 65 66 66 69  63 69 65 6e 74 00 65 66  |ncy.efficient.ef|
00001920  66 69 63 69 65 6e 74 6c  79 00 65 66 66 6f 72 74  |ficiently.effort|
00001930  00 65 69 67 68 74 00 65  69 74 68 65 72 00 65 6c  |.eight.either.el|
00001940  61 62 6f 72 61 74 65 64  00 65 6c 61 62 6f 72 61  |aborated.elabora|
00001950  74 69 6f 6e 00 65 6c 65  63 74 72 6f 6e 69 63 00  |tion.electronic.|
00001960  65 6c 65 6d 65 6e 74 00  65 6c 65 6d 65 6e 74 73  |element.elements|
00001970  00 65 6c 69 6d 69 6e 61  74 65 00 65 6c 69 6d 69  |.eliminate.elimi|
00001980  6e 61 74 65 73 00 65 6c  69 6d 69 6e 61 74 69 6f  |nates.eliminatio|
00001990  6e 00 65 6c 73 65 00 65  6c 73 65 77 68 65 72 65  |n.else.elsewhere|
000019a0  00 65 6d 62 65 64 64 65  64 00 65 6d 62 65 64 64  |.embedded.embedd|
000019b0  69 6e 67 00 65 6d 70 68  61 73 69 7a 65 00 65 6d  |ing.emphasize.em|
000019c0  70 68 61 73 69 7a 65 64  00 65 6d 70 68 61 73 69  |phasized.emphasi|
000019d0  7a 65 73 00 65 6d 70 6c  6f 79 65 65 00 65 6d 70  |zes.employee.emp|
000019e0  74 79 00 65 6e 61 62 6c  65 00 65 6e 63 61 70 73  |ty.enable.encaps|
000019f0  75 6c 61 74 65 00 65 6e  63 6c 6f 73 65 00 65 6e  |ulate.enclose.en|
00001a00  63 6c 6f 73 65 64 00 65  6e 63 6c 6f 73 69 6e 67  |closed.enclosing|
00001a10  00 65 6e 63 6f 75 6e 74  65 72 65 64 00 65 6e 63  |.encountered.enc|
00001a20  6f 75 6e 74 65 72 73 00  65 6e 63 72 79 70 74 65  |ounters.encrypte|
00001a30  64 00 65 6e 64 00 65 6e  64 73 00 65 6e 68 61 6e  |d.end.ends.enhan|
00001a40  63 65 6d 65 6e 74 73 00  65 6e 6f 75 67 68 00 65  |cements.enough.e|
00001a50  6e 73 75 72 65 00 65 6e  73 75 72 65 73 00 65 6e  |nsure.ensures.en|
00001a60  73 75 72 69 6e 67 00 65  6e 74 65 72 00 65 6e 74  |suring.enter.ent|
00001a70  65 72 65 64 00 65 6e 74  65 72 69 6e 67 00 65 6e  |ered.entering.en|
00001a80  74 65 72 73 00 65 6e 74  69 72 65 00 65 6e 74 69  |ters.entire.enti|
00001a90  72 65 6c 79 00 65 6e 74  69 74 69 65 73 00 65 6e  |rely.entities.en|
00001aa0  74 72 69 65 73 00 65 6e  74 72 79 00 65 6e 76 65  |tries.entry.enve|
00001ab0  6c 6f 70 65 00 65 6e 76  69 72 6f 6e 6d 65 6e 74  |lope.environment|
00001ac0  73 00 65 71 75 61 6c 00  65 71 75 61 6c 69 74 79  |s.equal.equality|
00001ad0  00 65 71 75 61 6c 6c 79  00 65 71 75 61 6c 73 00  |.equally.equals.|
00001ae0  65 71 75 61 74 69 6f 6e  00 65 71 75 69 76 61 6c  |equation.equival|
00001af0  65 6e 63 65 00 65 71 75  69 76 61 6c 65 6e 74 00  |ence.equivalent.|
00001b00  65 71 75 69 76 61 6c 65  6e 74 6c 79 00 65 71 75  |equivalently.equ|
00001b10  69 76 61 6c 65 6e 74 73  00 65 72 61 73 65 64 00  |ivalents.erased.|
00001b20  65 72 72 6f 72 00 65 72  72 6f 72 73 00 65 73 63  |error.errors.esc|
00001b30  61 70 65 00 65 73 70 65  63 69 61 6c 6c 79 00 65  |ape.especially.e|
00001b40  73 73 65 6e 74 69 61 6c  00 65 73 73 65 6e 74 69  |ssential.essenti|
00001b50  61 6c 6c 79 00 65 76 61  6c 75 61 74 65 00 65 76  |ally.evaluate.ev|
00001b60  61 6c 75 61 74 65 64 00  65 76 61 6c 75 61 74 65  |aluated.evaluate|
00001b70  73 00 65 76 61 6c 75 61  74 69 6e 67 00 65 76 61  |s.evaluating.eva|
00001b80  6c 75 61 74 69 6f 6e 00  65 76 65 6e 00 65 76 65  |luation.even.eve|
00001b90  6e 74 00 65 76 65 6e 74  75 61 6c 6c 79 00 65 76  |nt.eventually.ev|
00001ba0  65 72 00 65 76 65 72 79  00 65 76 65 72 79 74 68  |er.every.everyth|
00001bb0  69 6e 67 00 65 76 65 72  79 77 68 65 72 65 00 65  |ing.everywhere.e|
00001bc0  76 69 64 65 6e 74 6c 79  00 65 78 61 63 74 6c 79  |vidently.exactly|
00001bd0  00 65 78 61 6d 69 6e 65  00 65 78 61 6d 69 6e 65  |.examine.examine|
00001be0  64 00 65 78 61 6d 70 6c  65 00 65 78 61 6d 70 6c  |d.example.exampl|
00001bf0  65 73 00 65 78 63 65 65  64 00 65 78 63 65 65 64  |es.exceed.exceed|
00001c00  73 00 65 78 63 65 70 74  00 65 78 63 65 70 74 69  |s.except.excepti|
00001c10  6f 6e 00 65 78 63 65 73  73 00 65 78 63 68 61 6e  |on.excess.exchan|
00001c20  67 65 00 65 78 63 68 61  6e 67 65 64 00 65 78 63  |ge.exchanged.exc|
00001c30  68 61 6e 67 65 73 00 65  78 63 6c 75 64 69 6e 67  |hanges.excluding|
00001c40  00 65 78 63 6c 75 73 69  76 65 00 65 78 65 63 75  |.exclusive.execu|
00001c50  74 61 62 6c 65 00 65 78  65 63 75 74 65 00 65 78  |table.execute.ex|
00001c60  65 63 75 74 65 64 00 65  78 65 63 75 74 65 73 00  |ecuted.executes.|
00001c70  65 78 65 63 75 74 69 6e  67 00 65 78 65 63 75 74  |executing.execut|
00001c80  69 6f 6e 00 65 78 65 6d  70 6c 69 66 69 65 64 00  |ion.exemplified.|
00001c90  65 78 65 72 63 69 73 65  00 65 78 69 73 74 00 65  |exercise.exist.e|
00001ca0  78 69 73 74 65 6e 63 65  00 65 78 69 73 74 65 6e  |xistence.existen|
00001cb0  74 00 65 78 69 73 74 69  6e 67 00 65 78 69 73 74  |t.existing.exist|
00001cc0  73 00 65 78 69 74 00 65  78 69 74 65 64 00 65 78  |s.exit.exited.ex|
00001cd0  69 74 69 6e 67 00 65 78  69 74 73 00 65 78 70 61  |iting.exits.expa|
00001ce0  6e 64 65 64 00 65 78 70  61 6e 64 73 00 65 78 70  |nded.expands.exp|
00001cf0  61 6e 73 69 6f 6e 00 65  78 70 65 63 74 00 65 78  |ansion.expect.ex|
00001d00  70 65 63 74 65 64 00 65  78 70 65 63 74 73 00 65  |pected.expects.e|
00001d10  78 70 65 6e 73 69 76 65  00 65 78 70 65 72 69 65  |xpensive.experie|
00001d20  6e 63 65 64 00 65 78 70  65 72 69 6d 65 6e 74 00  |nced.experiment.|
00001d30  65 78 70 6c 61 6e 61 74  69 6f 6e 73 00 65 78 70  |explanations.exp|
00001d40  6c 69 63 69 74 00 65 78  70 6c 69 63 69 74 6c 79  |licit.explicitly|
00001d50  00 65 78 70 6f 6e 65 6e  74 69 61 74 69 6f 6e 00  |.exponentiation.|
00001d60  65 78 70 72 65 73 73 00  65 78 70 72 65 73 73 69  |express.expressi|
00001d70  6f 6e 00 65 78 70 72 65  73 73 69 6f 6e 73 00 65  |on.expressions.e|
00001d80  78 74 65 6e 64 65 64 00  65 78 74 65 6e 73 69 62  |xtended.extensib|
00001d90  6c 65 00 65 78 74 65 6e  73 69 6f 6e 00 65 78 74  |le.extension.ext|
00001da0  65 6e 73 69 6f 6e 73 00  65 78 74 65 6e 73 69 76  |ensions.extensiv|
00001db0  65 00 65 78 74 65 72 6e  61 6c 00 65 78 74 65 72  |e.external.exter|
00001dc0  6e 61 6c 6c 79 00 65 78  74 72 61 00 65 78 74 72  |nally.extra.extr|
00001dd0  61 63 74 65 64 00 65 78  74 72 65 6d 65 00 70 00  |acted.extreme.p.|
00001de0  00 00 2b 03 00 00 66 61  63 65 73 00 66 61 63 65  |..+...faces.face|
00001df0  74 73 00 66 61 63 69 6c  69 74 61 74 65 00 66 61  |ts.facilitate.fa|
00001e00  63 69 6c 69 74 69 65 73  00 66 61 63 69 6c 69 74  |cilities.facilit|
00001e10  79 00 66 61 63 69 6e 67  00 66 61 63 74 00 66 61  |y.facing.fact.fa|
00001e20  63 74 6f 72 00 66 61 68  72 65 6e 68 65 69 74 00  |ctor.fahrenheit.|
00001e30  66 61 69 6c 73 00 66 61  69 72 6c 79 00 66 61 6c  |fails.fairly.fal|
00001e40  6c 00 66 61 6c 6c 69 6e  67 00 66 61 6c 6c 73 00  |l.falling.falls.|
00001e50  66 61 6c 73 65 00 66 61  6c 73 65 68 6f 6f 64 00  |false.falsehood.|
00001e60  66 61 6d 69 6c 69 61 72  00 66 61 6d 69 6c 79 00  |familiar.family.|
00001e70  66 61 6e 73 00 66 61 72  00 66 61 73 68 69 6f 6e  |fans.far.fashion|
00001e80  00 66 61 73 74 00 66 61  73 74 65 72 00 66 61 73  |.fast.faster.fas|
00001e90  74 65 73 74 00 66 65 61  74 75 72 65 00 66 65 62  |test.feature.feb|
00001ea0  72 75 61 72 79 00 66 65  64 00 66 65 65 64 00 66  |ruary.fed.feed.f|
00001eb0  65 65 6c 00 66 65 74 63  68 00 66 65 74 63 68 65  |eel.fetch.fetche|
00001ec0  64 00 66 65 74 63 68 65  73 00 66 65 74 63 68 69  |d.fetches.fetchi|
00001ed0  6e 67 00 66 65 77 00 66  65 77 65 72 00 66 69 64  |ng.few.fewer.fid|
00001ee0  64 6c 69 6e 67 00 66 69  65 6c 64 00 66 69 65 6c  |dling.field.fiel|
00001ef0  64 73 00 66 69 6c 65 00  66 69 6c 65 72 00 66 69  |ds.file.filer.fi|
00001f00  6c 65 73 00 66 69 6c 69  6e 67 00 66 69 6c 6c 00  |les.filing.fill.|
00001f10  66 69 6c 6c 65 64 00 66  69 6c 6c 69 6e 67 00 66  |filled.filling.f|
00001f20  69 6c 6c 73 00 66 69 6e  61 6c 00 66 69 6e 61 6c  |ills.final.final|
00001f30  6c 79 00 66 69 6e 64 00  66 69 6e 64 69 6e 67 00  |ly.find.finding.|
00001f40  66 69 6e 64 73 00 66 69  6e 69 73 68 65 64 00 66  |finds.finished.f|
00001f50  69 6e 69 74 65 00 66 69  72 73 74 00 66 69 74 00  |inite.first.fit.|
00001f60  66 69 76 65 00 66 69 78  65 64 00 66 6c 61 67 00  |five.fixed.flag.|
00001f70  66 6c 61 67 73 00 66 6c  65 78 69 62 69 6c 69 74  |flags.flexibilit|
00001f80  79 00 66 6c 65 78 69 62  6c 65 00 66 6c 69 70 00  |y.flexible.flip.|
00001f90  66 6c 69 70 70 65 64 00  66 6c 6f 61 74 00 66 6c  |flipped.float.fl|
00001fa0  6f 61 74 69 6e 67 00 66  6c 6f 6f 64 00 66 6c 6f  |oating.flood.flo|
00001fb0  77 00 66 6f 6c 6c 6f 77  00 66 6f 6c 6c 6f 77 65  |w.follow.followe|
00001fc0  64 00 66 6f 6c 6c 6f 77  69 6e 67 00 66 6f 6c 6c  |d.following.foll|
00001fd0  6f 77 73 00 66 6f 72 00  66 6f 72 63 65 00 66 6f  |ows.for.force.fo|
00001fe0  72 63 65 64 00 66 6f 72  63 65 73 00 66 6f 72 65  |rced.forces.fore|
00001ff0  76 65 72 00 66 6f 72 6d  00 66 6f 72 6d 61 6c 00  |ver.form.formal.|
00002000  66 6f 72 6d 61 6c 6c 79  00 66 6f 72 6d 61 74 00  |formally.format.|
00002010  66 6f 72 6d 61 74 73 00  66 6f 72 6d 61 74 74 65  |formats.formatte|
00002020  64 00 66 6f 72 6d 65 72  00 66 6f 72 6d 73 00 66  |d.former.forms.f|
00002030  6f 72 6d 75 6c 61 00 66  6f 72 74 68 00 66 6f 72  |ormula.forth.for|
00002040  74 75 6e 61 74 65 6c 79  00 66 6f 72 77 61 72 64  |tunately.forward|
00002050  00 66 6f 75 6e 64 00 66  6f 75 72 00 66 6f 75 72  |.found.four.four|
00002060  74 68 00 66 6f 78 00 66  72 61 63 74 69 6f 6e 00  |th.fox.fraction.|
00002070  66 72 61 63 74 69 6f 6e  61 6c 00 66 72 61 67 6d  |fractional.fragm|
00002080  65 6e 74 00 66 72 61 75  67 68 74 00 66 72 65 65  |ent.fraught.free|
00002090  00 66 72 65 65 6c 79 00  66 72 65 71 75 65 6e 74  |.freely.frequent|
000020a0  00 66 72 65 71 75 65 6e  74 6c 79 00 66 72 65 73  |.frequently.fres|
000020b0  68 00 66 72 6f 6d 00 66  75 6c 6c 00 66 75 6c 6c  |h.from.full.full|
000020c0  79 00 66 75 6e 63 74 69  6f 6e 00 66 75 6e 63 74  |y.function.funct|
000020d0  69 6f 6e 61 6c 6c 79 00  66 75 6e 63 74 69 6f 6e  |ionally.function|
000020e0  73 00 66 75 6e 64 61 6d  65 6e 74 61 6c 00 66 75  |s.fundamental.fu|
000020f0  6e 74 69 6f 6e 00 66 75  72 74 68 65 72 00 66 75  |ntion.further.fu|
00002100  72 74 68 65 72 6d 6f 72  65 00 66 75 74 75 72 65  |rthermore.future|
00002110  00 28 00 00 00 43 01 00  00 67 61 70 00 67 61 72  |.(...C...gap.gar|
00002120  62 61 67 65 00 67 65 6e  65 72 61 6c 00 67 65 6e  |bage.general.gen|
00002130  65 72 61 6c 69 74 79 00  67 65 6e 65 72 61 6c 69  |erality.generali|
00002140  7a 61 74 69 6f 6e 00 67  65 6e 65 72 61 6c 69 7a  |zation.generaliz|
00002150  61 74 69 6f 6e 73 00 67  65 6e 65 72 61 6c 69 7a  |ations.generaliz|
00002160  65 00 67 65 6e 65 72 61  6c 6c 79 00 67 65 6e 65  |e.generally.gene|
00002170  72 61 74 65 00 67 65 6e  65 72 61 74 65 64 00 67  |rate.generated.g|
00002180  65 6e 65 72 61 74 69 6e  67 00 67 65 74 00 67 65  |enerating.get.ge|
00002190  74 73 00 67 65 74 74 69  6e 67 00 67 69 76 65 00  |ts.getting.give.|
000021a0  67 69 76 65 6e 00 67 69  76 65 73 00 67 69 76 69  |given.gives.givi|
000021b0  6e 67 00 67 6c 61 6e 63  65 00 67 6c 6f 62 61 6c  |ng.glance.global|
000021c0  00 67 6c 6f 62 61 6c 6c  79 00 67 6f 00 67 6f 65  |.globally.go.goe|
000021d0  73 00 67 6f 69 6e 67 00  67 6f 6e 65 00 67 6f 6f  |s.going.gone.goo|
000021e0  64 00 67 72 61 64 75 61  6c 6c 79 00 67 72 61 6d  |d.gradually.gram|
000021f0  6d 61 74 69 63 61 6c 00  67 72 61 6d 6d 61 74 69  |matical.grammati|
00002200  63 61 6c 6c 79 00 67 72  61 70 68 69 63 00 67 72  |cally.graphic.gr|
00002210  61 73 70 00 67 72 65 61  74 65 72 00 67 72 6f 75  |asp.greater.grou|
00002220  70 00 67 72 6f 75 70 65  64 00 67 72 6f 75 70 73  |p.grouped.groups|
00002230  00 67 72 6f 77 00 67 75  61 72 61 6e 74 65 65 00  |.grow.guarantee.|
00002240  67 75 61 72 61 6e 74 65  65 64 00 67 75 61 72 61  |guaranteed.guara|
00002250  6e 74 65 65 73 00 67 75  69 64 65 00 30 00 00 00  |ntees.guide.0...|
00002260  39 01 00 00 68 61 64 00  68 61 6c 66 00 68 61 6e  |9...had.half.han|
00002270  64 00 68 61 6e 64 65 64  00 68 61 6e 64 66 75 6c  |d.handed.handful|
00002280  00 68 61 6e 64 6c 65 00  68 61 6e 64 6c 65 73 00  |.handle.handles.|
00002290  68 61 6e 64 6c 69 6e 67  00 68 61 6e 64 79 00 68  |handling.handy.h|
000022a0  61 70 70 65 6e 00 68 61  70 70 65 6e 73 00 68 61  |appen.happens.ha|
000022b0  72 64 00 68 61 72 64 65  72 00 68 61 72 64 77 61  |rd.harder.hardwa|
000022c0  72 65 00 68 61 73 00 68  61 73 68 00 68 61 73 68  |re.has.hash.hash|
000022d0  65 64 00 68 61 73 68 69  6e 67 00 68 61 73 74 79  |ed.hashing.hasty|
000022e0  00 68 61 76 65 00 68 65  00 68 65 61 76 69 6c 79  |.have.he.heavily|
000022f0  00 68 65 6c 64 00 68 65  6c 6c 6f 00 68 65 6c 70  |.held.hello.help|
00002300  00 68 65 6e 00 68 65 6e  63 65 00 68 65 6e 63 65  |.hen.hence.hence|
00002310  66 6f 72 74 68 00 68 65  72 65 00 68 69 64 64 65  |forth.here.hidde|
00002320  6e 00 68 69 64 65 00 68  69 65 72 61 72 63 68 79  |n.hide.hierarchy|
00002330  00 68 69 67 68 00 68 69  67 68 65 72 00 68 69 67  |.high.higher.hig|
00002340  68 65 73 74 00 68 69 67  68 6c 69 67 68 74 65 64  |hest.highlighted|
00002350  00 68 6f 6c 64 00 68 6f  6c 64 69 6e 67 00 68 6f  |.hold.holding.ho|
00002360  6c 64 73 00 68 6f 6c 65  73 00 68 6f 6d 65 00 68  |lds.holes.home.h|
00002370  6f 73 74 00 68 6f 75 72  67 6c 61 73 73 00 68 6f  |ost.hourglass.ho|
00002380  75 72 73 00 68 6f 77 00  68 6f 77 65 76 65 72 00  |urs.how.however.|
00002390  68 75 6d 61 6e 00 68 75  72 64 6c 65 00 9c 00 00  |human.hurdle....|
000023a0  00 ed 05 00 00 69 00 69  63 6f 6e 00 69 64 65 61  |.....i.icon.idea|
000023b0  00 69 64 65 61 6c 00 69  64 65 61 6c 6c 79 00 69  |.ideal.ideally.i|
000023c0  64 65 6e 74 69 63 61 6c  00 69 64 65 6e 74 69 63  |dentical.identic|
000023d0  61 6c 6c 79 00 69 64 65  6e 74 69 66 69 65 64 00  |ally.identified.|
000023e0  69 64 65 6e 74 69 66 69  65 72 00 69 64 65 6e 74  |identifier.ident|
000023f0  69 66 69 65 72 73 00 69  64 69 6f 6d 00 69 64 69  |ifiers.idiom.idi|
00002400  6f 6d 73 00 69 64 6c 65  00 69 66 00 69 67 6e 6f  |oms.idle.if.igno|
00002410  72 65 00 69 67 6e 6f 72  65 64 00 69 67 6e 6f 72  |re.ignored.ignor|
00002420  65 73 00 69 6c 6c 65 67  61 6c 00 69 6c 6c 75 6d  |es.illegal.illum|
00002430  69 6e 61 74 69 6e 67 00  69 6c 6c 75 73 74 72 61  |inating.illustra|
00002440  74 65 00 69 6c 6c 75 73  74 72 61 74 65 64 00 69  |te.illustrated.i|
00002450  6c 6c 75 73 74 72 61 74  69 6f 6e 00 69 6d 61 67  |llustration.imag|
00002460  69 6e 65 00 69 6d 6d 65  64 69 61 74 65 00 69 6d  |ine.immediate.im|
00002470  6d 65 64 69 61 74 65 6c  79 00 69 6d 70 6c 65 6d  |mediately.implem|
00002480  65 6e 74 00 69 6d 70 6c  65 6d 65 6e 74 61 74 69  |ent.implementati|
00002490  6f 6e 00 69 6d 70 6c 65  6d 65 6e 74 61 74 69 6f  |on.implementatio|
000024a0  6e 73 00 69 6d 70 6c 65  6d 65 6e 74 65 64 00 69  |ns.implemented.i|
000024b0  6d 70 6c 69 63 61 74 69  6f 6e 00 69 6d 70 6c 69  |mplication.impli|
000024c0  63 61 74 69 6f 6e 73 00  69 6d 70 6c 69 63 69 74  |cations.implicit|
000024d0  00 69 6d 70 6c 69 63 69  74 6c 79 00 69 6d 70 6c  |.implicitly.impl|
000024e0  69 65 64 00 69 6d 70 6c  69 65 73 00 69 6d 70 6c  |ied.implies.impl|
000024f0  79 00 69 6d 70 6f 72 74  61 6e 74 00 69 6d 70 6f  |y.important.impo|
00002500  73 65 64 00 69 6d 70 6f  73 73 69 62 6c 65 00 69  |sed.impossible.i|
00002510  6d 70 72 6f 76 65 64 00  69 6d 70 72 6f 76 65 6d  |mproved.improvem|
00002520  65 6e 74 00 69 6d 70 72  6f 76 65 6d 65 6e 74 73  |ent.improvements|
00002530  00 69 6d 70 72 6f 76 69  6e 67 00 69 6e 00 69 6e  |.improving.in.in|
00002540  61 63 63 65 73 73 69 62  6c 65 00 69 6e 61 64 76  |accessible.inadv|
00002550  65 72 74 65 6e 74 00 69  6e 61 64 76 65 72 74 65  |ertent.inadverte|
00002560  6e 74 6c 79 00 69 6e 63  6c 75 64 65 00 69 6e 63  |ntly.include.inc|
00002570  6c 75 64 65 64 00 69 6e  63 6c 75 64 65 73 00 69  |luded.includes.i|
00002580  6e 63 6c 75 64 69 6e 67  00 69 6e 63 6c 75 73 69  |ncluding.inclusi|
00002590  6f 6e 00 69 6e 63 6c 75  73 69 76 65 00 69 6e 63  |on.inclusive.inc|
000025a0  6f 6d 69 6e 67 00 69 6e  63 6f 6e 73 69 73 74 65  |oming.inconsiste|
000025b0  6e 74 6c 79 00 69 6e 63  72 65 61 73 65 00 69 6e  |ntly.increase.in|
000025c0  63 72 65 61 73 65 64 00  69 6e 63 72 65 61 73 65  |creased.increase|
000025d0  73 00 69 6e 63 72 65 61  73 69 6e 67 00 69 6e 63  |s.increasing.inc|
000025e0  72 65 6d 65 6e 74 00 69  6e 63 72 65 6d 65 6e 74  |rement.increment|
000025f0  65 64 00 69 6e 63 72 65  6d 65 6e 74 69 6e 67 00  |ed.incrementing.|
00002600  69 6e 63 72 65 6d 65 6e  74 73 00 69 6e 64 65 65  |increments.indee|
00002610  64 00 69 6e 64 65 6e 74  61 74 69 6f 6e 00 69 6e  |d.indentation.in|
00002620  64 65 6e 74 65 64 00 69  6e 64 65 6e 74 69 6e 67  |dented.indenting|
00002630  00 69 6e 64 65 70 65 6e  64 61 6e 74 00 69 6e 64  |.independant.ind|
00002640  65 70 65 6e 64 65 6e 74  00 69 6e 64 65 78 00 69  |ependent.index.i|
00002650  6e 64 65 78 69 6e 67 00  69 6e 64 69 63 61 74 65  |ndexing.indicate|
00002660  00 69 6e 64 69 63 61 74  65 64 00 69 6e 64 69 63  |.indicated.indic|
00002670  61 74 65 73 00 69 6e 64  69 63 61 74 69 6e 67 00  |ates.indicating.|
00002680  69 6e 64 69 63 61 74 69  6f 6e 00 69 6e 64 69 72  |indication.indir|
00002690  65 63 74 6c 79 00 69 6e  64 69 76 69 64 75 61 6c  |ectly.individual|
000026a0  00 69 6e 64 69 76 69 64  75 61 6c 73 00 69 6e 65  |.individuals.ine|
000026b0  71 75 61 6c 69 74 79 00  69 6e 66 65 72 69 6f 72  |quality.inferior|
000026c0  00 69 6e 66 69 6e 69 74  65 00 69 6e 66 69 6e 69  |.infinite.infini|
000026d0  74 65 6c 79 00 69 6e 66  6f 72 6d 61 74 69 6f 6e  |tely.information|
000026e0  00 69 6e 68 65 72 65 6e  74 6c 79 00 69 6e 69 74  |.inherently.init|
000026f0  69 61 6c 00 69 6e 69 74  69 61 6c 6c 79 00 69 6e  |ial.initially.in|
00002700  69 74 69 61 74 65 64 00  69 6e 6e 61 72 64 73 00  |itiated.innards.|
00002710  69 6e 6e 65 72 00 69 6e  6e 6f 63 65 6e 63 65 00  |inner.innocence.|
00002720  69 6e 70 75 74 00 69 6e  73 65 6e 73 69 74 69 76  |input.insensitiv|
00002730  65 00 69 6e 73 65 72 74  65 64 00 69 6e 73 65 72  |e.inserted.inser|
00002740  74 69 6f 6e 00 69 6e 73  69 64 65 00 69 6e 73 74  |tion.inside.inst|
00002750  61 6c 6c 00 69 6e 73 74  61 6c 6c 65 64 00 69 6e  |all.installed.in|
00002760  73 74 61 6c 6c 73 00 69  6e 73 74 61 6e 63 65 00  |stalls.instance.|
00002770  69 6e 73 74 61 6e 63 65  73 00 69 6e 73 74 65 61  |instances.instea|
00002780  64 00 69 6e 73 74 72 75  63 74 69 6f 6e 73 00 69  |d.instructions.i|
00002790  6e 73 74 72 75 63 74 69  76 65 00 69 6e 74 65 67  |nstructive.integ|
000027a0  65 72 00 69 6e 74 65 67  65 72 73 00 69 6e 74 65  |er.integers.inte|
000027b0  67 72 61 74 69 6f 6e 00  69 6e 74 65 6c 6c 69 67  |gration.intellig|
000027c0  65 6e 74 00 69 6e 74 65  6c 6c 69 67 65 6e 74 6c  |ent.intelligentl|
000027d0  79 00 69 6e 74 65 6e 64  65 64 00 69 6e 74 65 6e  |y.intended.inten|
000027e0  74 00 69 6e 74 65 72 61  63 74 69 6f 6e 73 00 69  |t.interactions.i|
000027f0  6e 74 65 72 63 68 61 6e  67 65 00 69 6e 74 65 72  |nterchange.inter|
00002800  65 73 74 00 69 6e 74 65  72 65 73 74 69 6e 67 00  |est.interesting.|
00002810  69 6e 74 65 72 66 61 63  65 73 00 69 6e 74 65 72  |interfaces.inter|
00002820  66 65 72 65 00 69 6e 74  65 72 6c 65 61 76 65 64  |fere.interleaved|
00002830  00 69 6e 74 65 72 6d 65  64 69 61 74 65 00 69 6e  |.intermediate.in|
00002840  74 65 72 6d 69 78 65 64  00 69 6e 74 65 72 6e 61  |termixed.interna|
00002850  6c 00 69 6e 74 65 72 6e  61 6c 6c 79 00 69 6e 74  |l.internally.int|
00002860  65 72 70 72 65 74 00 69  6e 74 65 72 70 72 65 74  |erpret.interpret|
00002870  61 74 69 6f 6e 00 69 6e  74 65 72 70 72 65 74 65  |ation.interprete|
00002880  64 00 69 6e 74 65 72 70  72 65 74 65 72 00 69 6e  |d.interpreter.in|
00002890  74 65 72 76 61 6c 00 69  6e 74 65 72 76 65 6e 69  |terval.interveni|
000028a0  6e 67 00 69 6e 74 6f 00  69 6e 74 72 6f 64 75 63  |ng.into.introduc|
000028b0  65 64 00 69 6e 74 72 6f  64 75 63 65 73 00 69 6e  |ed.introduces.in|
000028c0  74 72 6f 64 75 63 74 69  6f 6e 00 69 6e 76 65 72  |troduction.inver|
000028d0  73 65 00 69 6e 76 65 72  73 69 6f 6e 00 69 6e 76  |se.inversion.inv|
000028e0  65 73 74 69 67 61 74 65  00 69 6e 76 65 73 74 69  |estigate.investi|
000028f0  67 61 74 65 64 00 69 6e  76 69 73 69 62 6c 65 00  |gated.invisible.|
00002900  69 6e 76 6f 63 61 74 69  6f 6e 00 69 6e 76 6f 63  |invocation.invoc|
00002910  61 74 69 6f 6e 73 00 69  6e 76 6f 6b 65 00 69 6e  |ations.invoke.in|
00002920  76 6f 6b 65 64 00 69 6e  76 6f 6c 76 65 00 69 6e  |voked.involve.in|
00002930  76 6f 6c 76 65 64 00 69  6e 76 6f 6c 76 65 73 00  |volved.involves.|
00002940  69 6e 76 6f 6c 76 69 6e  67 00 69 72 72 65 6c 65  |involving.irrele|
00002950  76 61 6e 74 00 69 73 00  69 73 6f 6c 61 74 65 64  |vant.is.isolated|
00002960  00 69 73 73 75 65 00 69  73 73 75 65 64 00 69 73  |.issue.issued.is|
00002970  73 75 65 73 00 69 74 00  69 74 65 6d 00 69 74 65  |sues.it.item.ite|
00002980  72 61 74 69 6f 6e 00 69  74 73 00 69 74 73 65 6c  |ration.its.itsel|
00002990  66 00 06 00 00 00 22 00  00 00 6a 61 6e 75 61 72  |f....."...januar|
000029a0  79 00 6a 6f 62 00 6a 75  6c 79 00 6a 75 6d 70 65  |y.job.july.jumpe|
000029b0  64 00 6a 75 6e 65 00 6a  75 73 74 00 0e 00 00 00  |d.june.just.....|
000029c0  5a 00 00 00 6b 65 65 70  00 6b 65 65 70 69 6e 67  |Z...keep.keeping|
000029d0  00 6b 65 65 70 73 00 6b  65 70 74 00 6b 65 79 00  |.keeps.kept.key.|
000029e0  6b 65 79 62 6f 61 72 64  00 6b 65 79 77 6f 72 64  |keyboard.keyword|
000029f0  00 6b 65 79 77 6f 72 64  73 00 6b 69 6e 64 00 6b  |.keywords.kind.k|
00002a00  69 6e 64 73 00 6b 6e 6f  77 00 6b 6e 6f 77 69 6e  |inds.know.knowin|
00002a10  67 00 6b 6e 6f 77 6e 00  6b 6e 6f 77 73 00 5c 00  |g.known.knows.\.|
00002a20  00 00 80 02 00 00 6c 61  62 65 6c 00 6c 61 62 65  |......label.labe|
00002a30  6c 6c 65 64 00 6c 61 62  65 6c 73 00 6c 61 6e 67  |lled.labels.lang|
00002a40  75 61 67 65 00 6c 61 6e  67 75 61 67 65 73 00 6c  |uage.languages.l|
00002a50  61 72 67 65 00 6c 61 72  67 65 6c 79 00 6c 61 72  |arge.largely.lar|
00002a60  67 65 72 00 6c 61 72 67  65 73 74 00 6c 61 73 74  |ger.largest.last|
00002a70  00 6c 61 73 74 73 00 6c  61 74 65 72 00 6c 61 74  |.lasts.later.lat|
00002a80  74 65 72 00 6c 61 77 73  00 6c 61 7a 79 00 6c 65  |ter.laws.lazy.le|
00002a90  61 64 00 6c 65 61 64 69  6e 67 00 6c 65 61 64 73  |ad.leading.leads|
00002aa0  00 6c 65 61 70 00 6c 65  61 72 6e 00 6c 65 61 72  |.leap.learn.lear|
00002ab0  6e 65 64 00 6c 65 61 73  74 00 6c 65 61 76 65 00  |ned.least.leave.|
00002ac0  6c 65 61 76 65 73 00 6c  65 61 76 69 6e 67 00 6c  |leaves.leaving.l|
00002ad0  65 64 00 6c 65 65 00 6c  65 66 74 00 6c 65 67 61  |ed.lee.left.lega|
00002ae0  6c 00 6c 65 67 69 74 69  6d 61 74 65 6c 79 00 6c  |l.legitimately.l|
00002af0  65 6e 67 74 68 00 6c 65  6e 67 74 68 73 00 6c 65  |ength.lengths.le|
00002b00  73 73 00 6c 65 74 00 6c  65 74 73 00 6c 65 74 74  |ss.let.lets.lett|
00002b10  65 72 00 6c 65 74 74 65  72 73 00 6c 65 76 65 6c  |er.letters.level|
00002b20  00 6c 65 76 65 6c 73 00  6c 65 78 69 63 6f 67 72  |.levels.lexicogr|
00002b30  61 70 68 69 63 00 6c 65  78 69 63 6f 67 72 61 70  |aphic.lexicograp|
00002b40  68 69 63 61 6c 6c 79 00  6c 69 61 62 69 6c 69 74  |hically.liabilit|
00002b50  79 00 6c 69 62 65 72 74  69 65 73 00 6c 69 62 65  |y.liberties.libe|
00002b60  72 74 79 00 6c 69 62 72  61 72 69 65 73 00 6c 69  |rty.libraries.li|
00002b70  62 72 61 72 79 00 6c 69  63 65 6e 63 65 00 6c 69  |brary.licence.li|
00002b80  65 00 6c 69 65 73 00 6c  69 66 65 74 69 6d 65 00  |e.lies.lifetime.|
00002b90  6c 69 6b 65 00 6c 69 6b  65 6c 79 00 6c 69 6d 65  |like.likely.lime|
00002ba0  00 6c 69 6d 69 74 00 6c  69 6d 69 74 61 74 69 6f  |.limit.limitatio|
00002bb0  6e 73 00 6c 69 6d 69 74  65 64 00 6c 69 6d 69 74  |ns.limited.limit|
00002bc0  73 00 6c 69 6e 65 00 6c  69 6e 65 61 72 00 6c 69  |s.line.linear.li|
00002bd0  6e 65 73 00 6c 69 73 74  00 6c 69 73 74 65 64 00  |nes.list.listed.|
00002be0  6c 69 73 74 69 6e 67 00  6c 69 73 74 73 00 6c 69  |listing.lists.li|
00002bf0  74 65 72 61 6c 00 6c 69  74 74 6c 65 00 6c 6f 61  |teral.little.loa|
00002c00  64 00 6c 6f 61 64 65 64  00 6c 6f 61 64 65 72 73  |d.loaded.loaders|
00002c10  00 6c 6f 61 64 69 6e 67  00 6c 6f 63 61 6c 00 6c  |.loading.local.l|
00002c20  6f 63 61 74 65 64 00 6c  6f 63 61 74 69 6f 6e 00  |ocated.location.|
00002c30  6c 6f 67 69 63 61 6c 00  6c 6f 67 69 63 61 6c 6c  |logical.logicall|
00002c40  79 00 6c 6f 6e 67 00 6c  6f 6e 67 65 72 00 6c 6f  |y.long.longer.lo|
00002c50  6e 67 65 73 74 00 6c 6f  6f 6b 00 6c 6f 6f 6b 65  |ngest.look.looke|
00002c60  64 00 6c 6f 6f 6b 69 6e  67 00 6c 6f 6f 6b 73 00  |d.looking.looks.|
00002c70  6c 6f 6f 70 00 6c 6f 6f  70 73 00 6c 6f 6f 73 65  |loop.loops.loose|
00002c80  00 6c 6f 73 73 00 6c 6f  73 74 00 6c 6f 74 00 6c  |.loss.lost.lot.l|
00002c90  6f 77 00 6c 6f 77 65 72  00 6c 75 63 6b 79 00 6c  |ow.lower.lucky.l|
00002ca0  75 6d 70 65 64 00 83 00  00 00 0b 04 00 00 6d 61  |umped.........ma|
00002cb0  63 68 69 6e 65 00 6d 61  63 68 69 6e 65 73 00 6d  |chine.machines.m|
00002cc0  61 64 65 00 6d 61 67 61  7a 69 6e 65 73 00 6d 61  |ade.magazines.ma|
00002cd0  67 69 63 00 6d 61 67 6e  69 66 69 63 61 74 69 6f  |gic.magnificatio|
00002ce0  6e 00 6d 61 67 6e 69 66  69 65 64 00 6d 61 67 6e  |n.magnified.magn|
00002cf0  69 66 79 00 6d 61 69 6c  00 6d 61 69 6e 00 6d 61  |ify.mail.main.ma|
00002d00  69 6e 6c 79 00 6d 61 69  6e 74 61 69 6e 00 6d 61  |inly.maintain.ma|
00002d10  69 6e 74 61 69 6e 65 64  00 6d 61 69 6e 74 61 69  |intained.maintai|
00002d20  6e 69 6e 67 00 6d 61 69  6e 74 61 69 6e 73 00 6d  |ning.maintains.m|
00002d30  61 6a 6f 72 00 6d 61 6a  6f 72 69 74 79 00 6d 61  |ajor.majority.ma|
00002d40  6b 65 00 6d 61 6b 65 72  00 6d 61 6b 65 73 00 6d  |ke.maker.makes.m|
00002d50  61 6b 69 6e 67 00 6d 61  6e 61 67 65 64 00 6d 61  |aking.managed.ma|
00002d60  6e 61 67 65 6d 65 6e 74  00 6d 61 6e 61 67 69 6e  |nagement.managin|
00002d70  67 00 6d 61 6e 64 61 74  6f 72 79 00 6d 61 6e 69  |g.mandatory.mani|
00002d80  70 75 6c 61 74 65 00 6d  61 6e 69 70 75 6c 61 74  |pulate.manipulat|
00002d90  65 64 00 6d 61 6e 69 70  75 6c 61 74 65 73 00 6d  |ed.manipulates.m|
00002da0  61 6e 69 70 75 6c 61 74  69 6e 67 00 6d 61 6e 69  |anipulating.mani|
00002db0  70 75 6c 61 74 69 6f 6e  00 6d 61 6e 69 70 75 6c  |pulation.manipul|
00002dc0  61 74 69 6f 6e 73 00 6d  61 6e 6e 65 72 00 6d 61  |ations.manner.ma|
00002dd0  6e 75 61 6c 6c 79 00 6d  61 6e 79 00 6d 61 70 73  |nually.many.maps|
00002de0  00 6d 61 72 63 68 00 6d  61 72 63 68 65 64 00 6d  |.march.marched.m|
00002df0  61 72 67 69 6e 00 6d 61  72 6b 00 6d 61 72 6b 73  |argin.mark.marks|
00002e00  00 6d 61 72 76 65 6c 6c  6f 75 73 00 6d 61 73 6b  |.marvellous.mask|
00002e10  00 6d 61 73 6b 69 6e 67  00 6d 61 73 6b 73 00 6d  |.masking.masks.m|
00002e20  61 73 74 65 72 65 64 00  6d 61 74 63 68 00 6d 61  |astered.match.ma|
00002e30  74 63 68 65 64 00 6d 61  74 63 68 65 73 00 6d 61  |tched.matches.ma|
00002e40  74 63 68 69 6e 67 00 6d  61 74 68 65 6d 61 74 69  |tching.mathemati|
00002e50  63 61 6c 00 6d 61 74 74  65 72 00 6d 61 74 74 65  |cal.matter.matte|
00002e60  72 73 00 6d 61 78 69 6d  75 6d 00 6d 61 79 00 6d  |rs.maximum.may.m|
00002e70  65 00 6d 65 61 6e 00 6d  65 61 6e 69 6e 67 00 6d  |e.mean.meaning.m|
00002e80  65 61 6e 69 6e 67 66 75  6c 00 6d 65 61 6e 69 6e  |eaningful.meanin|
00002e90  67 66 75 6c 6c 79 00 6d  65 61 6e 69 6e 67 6c 65  |gfully.meaningle|
00002ea0  73 73 00 6d 65 61 6e 73  00 6d 65 61 6e 74 69 6d  |ss.means.meantim|
00002eb0  65 00 6d 65 63 68 61 6e  69 63 61 6c 00 6d 65 63  |e.mechanical.mec|
00002ec0  68 61 6e 69 63 73 00 6d  65 63 68 61 6e 69 73 6d  |hanics.mechanism|
00002ed0  00 6d 65 63 68 61 6e 69  73 6d 73 00 6d 65 64 69  |.mechanisms.medi|
00002ee0  75 6d 00 6d 65 65 74 00  6d 65 65 74 73 00 6d 65  |um.meet.meets.me|
00002ef0  6d 62 65 72 00 6d 65 6d  62 65 72 73 00 6d 65 6d  |mber.members.mem|
00002f00  6f 72 79 00 6d 65 6e 00  6d 65 6e 74 69 6f 6e 65  |ory.men.mentione|
00002f10  64 00 6d 65 6e 74 69 6f  6e 69 6e 67 00 6d 65 6e  |d.mentioning.men|
00002f20  75 00 6d 65 72 65 6c 79  00 6d 65 72 69 74 00 6d  |u.merely.merit.m|
00002f30  65 73 73 00 6d 65 73 73  61 67 65 00 6d 65 74 00  |ess.message.met.|
00002f40  6d 65 74 68 6f 64 00 6d  65 74 68 6f 64 73 00 6d  |method.methods.m|
00002f50  69 63 72 6f 00 6d 69 64  64 6c 65 00 6d 69 67 68  |icro.middle.migh|
00002f60  74 00 6d 69 6d 69 63 73  00 6d 69 6e 64 00 6d 69  |t.mimics.mind.mi|
00002f70  6e 65 00 6d 69 6e 69 6d  61 6c 00 6d 69 6e 69 6d  |ne.minimal.minim|
00002f80  69 7a 65 64 00 6d 69 6e  69 6d 75 6d 00 6d 69 6e  |ized.minimum.min|
00002f90  6f 72 00 6d 69 6e 75 73  00 6d 69 73 73 69 6e 67  |or.minus.missing|
00002fa0  00 6d 69 73 73 70 65 6c  74 00 6d 69 73 74 61 6b  |.misspelt.mistak|
00002fb0  65 00 6d 69 73 75 73 65  00 6d 69 78 65 64 00 6d  |e.misuse.mixed.m|
00002fc0  69 78 74 75 72 65 00 6d  6e 65 6d 6f 6e 69 63 00  |ixture.mnemonic.|
00002fd0  6d 6f 64 65 00 6d 6f 64  65 6c 00 6d 6f 64 65 73  |mode.model.modes|
00002fe0  74 00 6d 6f 64 69 66 69  63 61 74 69 6f 6e 00 6d  |t.modification.m|
00002ff0  6f 64 69 66 69 63 61 74  69 6f 6e 73 00 6d 6f 64  |odifications.mod|
00003000  69 66 69 65 64 00 6d 6f  64 69 66 79 00 6d 6f 64  |ified.modify.mod|
00003010  69 66 79 69 6e 67 00 6d  6f 64 75 6c 65 00 6d 6f  |ifying.module.mo|
00003020  64 75 6c 75 73 00 6d 6f  6d 65 6e 74 00 6d 6f 6e  |dulus.moment.mon|
00003030  74 68 00 6d 6f 72 61 6c  00 6d 6f 72 65 00 6d 6f  |th.moral.more.mo|
00003040  73 74 00 6d 6f 73 74 6c  79 00 6d 6f 76 65 00 6d  |st.mostly.move.m|
00003050  6f 76 65 64 00 6d 6f 76  65 73 00 6d 6f 76 69 6e  |oved.moves.movin|
00003060  67 00 6d 75 63 68 00 6d  75 6c 74 69 00 6d 75 6c  |g.much.multi.mul|
00003070  74 69 70 6c 65 00 6d 75  6c 74 69 70 6c 69 63 61  |tiple.multiplica|
00003080  74 69 6f 6e 00 6d 75 6c  74 69 70 6c 69 65 64 00  |tion.multiplied.|
00003090  6d 75 6c 74 69 70 6c 69  65 72 00 6d 75 6c 74 69  |multiplier.multi|
000030a0  70 6c 79 00 6d 75 73 74  00 6d 79 00 6d 79 73 74  |ply.must.my.myst|
000030b0  65 72 69 6f 75 73 6c 79  00 35 00 00 00 7a 01 00  |eriously.5...z..|
000030c0  00 6e 61 6d 65 00 6e 61  6d 65 64 00 6e 61 6d 65  |.name.named.name|
000030d0  73 00 6e 61 6d 69 6e 67  00 6e 61 73 74 79 00 6e  |s.naming.nasty.n|
000030e0  61 74 75 72 61 6c 00 6e  61 74 75 72 61 6c 6c 79  |atural.naturally|
000030f0  00 6e 61 74 75 72 65 00  6e 65 61 72 00 6e 65 61  |.nature.near.nea|
00003100  74 6c 79 00 6e 65 63 65  73 73 61 72 69 6c 79 00  |tly.necessarily.|
00003110  6e 65 63 65 73 73 61 72  79 00 6e 65 65 64 00 6e  |necessary.need.n|
00003120  65 65 64 65 64 00 6e 65  65 64 73 00 6e 65 67 61  |eeded.needs.nega|
00003130  74 69 76 65 00 6e 65 69  74 68 65 72 00 6e 65 73  |tive.neither.nes|
00003140  74 00 6e 65 73 74 65 64  00 6e 65 73 74 69 6e 67  |t.nested.nesting|
00003150  00 6e 65 74 00 6e 65 76  65 72 00 6e 65 77 00 6e  |.net.never.new.n|
00003160  65 77 63 6f 6d 65 72 73  00 6e 65 78 74 00 6e 69  |ewcomers.next.ni|
00003170  63 65 00 6e 69 63 65 6c  79 00 6e 6f 00 6e 6f 64  |ce.nicely.no.nod|
00003180  65 00 6e 6f 64 65 73 00  6e 6f 6e 65 00 6e 6f 6e  |e.nodes.none.non|
00003190  73 65 6e 73 65 00 6e 6f  72 6d 61 6c 00 6e 6f 72  |sense.normal.nor|
000031a0  6d 61 6c 6c 79 00 6e 6f  74 00 6e 6f 74 61 62 6c  |mally.not.notabl|
000031b0  79 00 6e 6f 74 61 74 69  6f 6e 00 6e 6f 74 61 74  |y.notation.notat|
000031c0  69 6f 6e 61 6c 00 6e 6f  74 65 00 6e 6f 74 65 64  |ional.note.noted|
000031d0  00 6e 6f 74 68 69 6e 67  00 6e 6f 74 69 63 65 00  |.nothing.notice.|
000031e0  6e 6f 76 65 6d 62 65 72  00 6e 6f 77 00 6e 75 69  |november.now.nui|
000031f0  73 61 6e 63 65 00 6e 75  6c 6c 00 6e 75 6d 62 65  |sance.null.numbe|
00003200  72 00 6e 75 6d 62 65 72  69 6e 67 00 6e 75 6d 62  |r.numbering.numb|
00003210  65 72 73 00 6e 75 6d 65  72 69 63 00 6e 75 6d 65  |ers.numeric.nume|
00003220  72 69 63 61 6c 00 6e 75  6d 65 72 69 63 61 6c 6c  |rical.numericall|
00003230  79 00 6e 75 6d 65 72 6f  75 73 00 4b 00 00 00 24  |y.numerous.K...$|
00003240  02 00 00 6f 61 6b 00 6f  62 65 79 00 6f 62 6a 65  |...oak.obey.obje|
00003250  63 74 00 6f 62 6a 65 63  74 73 00 6f 62 73 65 72  |ct.objects.obser|
00003260  76 61 74 69 6f 6e 00 6f  62 73 65 72 76 65 00 6f  |vation.observe.o|
00003270  62 73 65 72 76 65 64 00  6f 62 74 61 69 6e 00 6f  |bserved.obtain.o|
00003280  62 74 61 69 6e 65 64 00  6f 62 76 69 6f 75 73 00  |btained.obvious.|
00003290  6f 62 76 69 6f 75 73 6c  79 00 6f 63 63 75 70 69  |obviously.occupi|
000032a0  65 73 00 6f 63 63 75 70  79 00 6f 63 63 75 72 00  |es.occupy.occur.|
000032b0  6f 63 63 75 72 72 65 6e  63 65 00 6f 63 63 75 72  |occurrence.occur|
000032c0  72 65 6e 63 65 73 00 6f  63 63 75 72 73 00 6f 63  |rences.occurs.oc|
000032d0  74 6f 62 65 72 00 6f 64  64 00 6f 66 00 6f 66 66  |tober.odd.of.off|
000032e0  00 6f 66 66 65 72 00 6f  66 66 65 72 73 00 6f 66  |.offer.offers.of|
000032f0  66 73 65 74 00 6f 66 74  65 6e 00 6f 6b 00 6f 6c  |fset.often.ok.ol|
00003300  64 00 6f 6c 64 65 72 00  6f 6d 69 74 00 6f 6d 69  |d.older.omit.omi|
00003310  74 74 65 64 00 6f 6d 6d  69 74 65 64 00 6f 6d 6d  |tted.ommited.omm|
00003320  69 74 74 65 64 00 6f 6e  00 6f 6e 63 65 00 6f 6e  |itted.on.once.on|
00003330  65 00 6f 6e 65 73 00 6f  6e 6c 79 00 6f 70 65 6e  |e.ones.only.open|
00003340  00 6f 70 65 6e 65 64 00  6f 70 65 6e 69 6e 67 00  |.opened.opening.|
00003350  6f 70 65 6e 73 00 6f 70  65 72 61 74 65 00 6f 70  |opens.operate.op|
00003360  65 72 61 74 69 6e 67 00  6f 70 65 72 61 74 69 6f  |erating.operatio|
00003370  6e 00 6f 70 65 72 61 74  69 6f 6e 73 00 6f 70 65  |n.operations.ope|
00003380  72 61 74 6f 72 00 6f 70  65 72 61 74 6f 72 73 00  |rator.operators.|
00003390  6f 70 70 6f 73 69 74 65  00 6f 70 74 69 6f 6e 00  |opposite.option.|
000033a0  6f 70 74 69 6f 6e 61 6c  00 6f 70 74 69 6f 6e 61  |optional.optiona|
000033b0  6c 6c 79 00 6f 72 00 6f  72 64 65 72 00 6f 72 64  |lly.or.order.ord|
000033c0  65 72 65 64 00 6f 72 64  65 72 69 6e 67 00 6f 72  |ered.ordering.or|
000033d0  64 69 6e 61 72 79 00 6f  72 67 61 6e 69 7a 61 74  |dinary.organizat|
000033e0  69 6f 6e 00 6f 72 67 61  6e 69 7a 65 00 6f 72 69  |ion.organize.ori|
000033f0  67 69 6e 00 6f 72 69 67  69 6e 61 6c 00 6f 72 69  |gin.original.ori|
00003400  67 69 6e 61 6c 6c 79 00  6f 74 68 65 72 00 6f 74  |ginally.other.ot|
00003410  68 65 72 73 00 6f 74 68  65 72 77 69 73 65 00 6f  |hers.otherwise.o|
00003420  75 72 00 6f 75 74 00 6f  75 74 65 72 00 6f 75 74  |ur.out.outer.out|
00003430  6c 69 6e 65 00 6f 75 74  70 75 74 00 6f 75 74 73  |line.output.outs|
00003440  69 64 65 00 6f 76 65 72  00 6f 76 65 72 66 6c 6f  |ide.over.overflo|
00003450  77 00 6f 76 65 72 68 65  61 64 00 6f 76 65 72 6c  |w.overhead.overl|
00003460  61 70 00 6f 77 6e 00 c3  00 00 00 94 06 00 00 70  |ap.own.........p|
00003470  61 63 6b 00 70 61 63 6b  61 67 65 00 70 61 63 6b  |ack.package.pack|
00003480  61 67 65 73 00 70 61 64  64 69 6e 67 00 70 61 67  |ages.padding.pag|
00003490  65 00 70 61 69 6e 00 70  61 69 6e 73 74 61 6b 69  |e.pain.painstaki|
000034a0  6e 67 6c 79 00 70 61 69  6e 74 00 70 61 69 72 00  |ngly.paint.pair.|
000034b0  70 61 69 72 65 64 00 70  61 69 72 73 00 70 61 72  |paired.pairs.par|
000034c0  61 6c 6c 65 6c 00 70 61  72 61 6d 65 74 65 72 00  |allel.parameter.|
000034d0  70 61 72 61 6d 65 74 65  72 73 00 70 61 72 65 6e  |parameters.paren|
000034e0  74 00 70 61 72 65 6e 74  68 65 73 65 73 00 70 61  |t.parentheses.pa|
000034f0  72 65 6e 74 68 65 73 69  73 00 70 61 72 65 6e 74  |renthesis.parent|
00003500  68 65 73 69 7a 65 64 00  70 61 72 74 00 70 61 72  |hesized.part.par|
00003510  74 69 63 69 70 61 74 65  00 70 61 72 74 69 63 75  |ticipate.particu|
00003520  6c 61 72 00 70 61 72 74  69 63 75 6c 61 72 6c 79  |lar.particularly|
00003530  00 70 61 72 74 6c 79 00  70 61 72 74 73 00 70 61  |.partly.parts.pa|
00003540  72 74 79 00 70 61 73 73  00 70 61 73 73 65 64 00  |rty.pass.passed.|
00003550  70 61 73 73 65 73 00 70  61 73 73 69 6e 67 00 70  |passes.passing.p|
00003560  61 74 74 65 72 6e 00 70  61 74 74 65 72 6e 73 00  |attern.patterns.|
00003570  70 61 79 6d 65 6e 74 00  70 65 6e 00 70 65 6f 70  |payment.pen.peop|
00003580  6c 65 00 70 65 72 00 70  65 72 63 65 6e 74 00 70  |le.per.percent.p|
00003590  65 72 63 65 6e 74 61 67  65 00 70 65 72 63 6f 6c  |ercentage.percol|
000035a0  61 74 65 64 00 70 65 72  66 65 63 74 6c 79 00 70  |ated.perfectly.p|
000035b0  65 72 66 6f 72 6d 00 70  65 72 66 6f 72 6d 61 6e  |erform.performan|
000035c0  63 65 00 70 65 72 66 6f  72 6d 65 64 00 70 65 72  |ce.performed.per|
000035d0  66 6f 72 6d 69 6e 67 00  70 65 72 66 6f 72 6d 73  |forming.performs|
000035e0  00 70 65 72 68 61 70 73  00 70 65 72 69 6c 00 70  |.perhaps.peril.p|
000035f0  65 72 6d 61 6e 65 6e 63  65 00 70 65 72 6d 61 6e  |ermanence.perman|
00003600  65 6e 74 00 70 65 72 6d  61 6e 65 6e 74 6c 79 00  |ent.permanently.|
00003610  70 65 72 6d 69 73 73 69  62 6c 65 00 70 65 72 6d  |permissible.perm|
00003620  69 73 73 69 6f 6e 00 70  65 72 6d 69 73 73 69 76  |ission.permissiv|
00003630  65 00 70 65 72 6d 69 74  00 70 65 72 6d 69 74 73  |e.permit.permits|
00003640  00 70 65 72 6d 69 74 74  65 64 00 70 65 72 6e 69  |.permitted.perni|
00003650  63 69 6f 75 73 00 70 65  72 73 6f 6e 00 70 65 72  |cious.person.per|
00003660  73 6f 6e 61 6c 00 70 68  6f 6e 65 00 70 68 72 61  |sonal.phone.phra|
00003670  73 65 64 00 70 68 79 73  69 63 61 6c 00 70 69 63  |sed.physical.pic|
00003680  6b 00 70 69 63 6b 69 6e  67 00 70 69 65 63 65 00  |k.picking.piece.|
00003690  70 69 65 63 65 73 00 70  6c 61 63 65 00 70 6c 61  |pieces.place.pla|
000036a0  63 65 64 00 70 6c 61 63  65 73 00 70 6c 61 63 69  |ced.places.placi|
000036b0  6e 67 00 70 6c 61 69 6e  00 70 6c 65 61 73 65 00  |ng.plain.please.|
000036c0  70 6c 65 61 73 65 73 00  70 6c 65 6e 74 79 00 70  |pleases.plenty.p|
000036d0  6c 6f 74 00 70 6c 6f 74  73 00 70 6c 6f 74 74 65  |lot.plots.plotte|
000036e0  64 00 70 6c 75 73 00 70  6f 69 6e 74 00 70 6f 69  |d.plus.point.poi|
000036f0  6e 74 65 64 00 70 6f 69  6e 74 65 72 00 70 6f 69  |nted.pointer.poi|
00003700  6e 74 65 72 73 00 70 6f  69 6e 74 69 6e 67 00 70  |nters.pointing.p|
00003710  6f 69 6e 74 73 00 70 6f  6c 69 73 68 00 70 6f 6c  |oints.polish.pol|
00003720  79 67 6f 6e 73 00 70 6f  70 70 65 64 00 70 6f 70  |ygons.popped.pop|
00003730  70 69 6e 67 00 70 6f 70  75 6c 61 72 00 70 6f 72  |ping.popular.por|
00003740  74 61 62 69 6c 69 74 79  00 70 6f 72 74 61 62 6c  |tability.portabl|
00003750  65 00 70 6f 73 69 74 69  6f 6e 00 70 6f 73 69 74  |e.position.posit|
00003760  69 6f 6e 65 64 00 70 6f  73 69 74 69 6f 6e 69 6e  |ioned.positionin|
00003770  67 00 70 6f 73 69 74 69  6f 6e 73 00 70 6f 73 69  |g.positions.posi|
00003780  74 69 76 65 00 70 6f 73  73 69 62 69 6c 69 74 79  |tive.possibility|
00003790  00 70 6f 73 73 69 62 6c  65 00 70 6f 73 73 69 62  |.possible.possib|
000037a0  6c 79 00 70 6f 73 74 66  69 78 00 70 6f 74 65 6e  |ly.postfix.poten|
000037b0  74 69 61 6c 00 70 6f 74  65 6e 74 69 61 6c 6c 79  |tial.potentially|
000037c0  00 70 6f 77 65 72 00 70  6f 77 65 72 73 00 70 72  |.power.powers.pr|
000037d0  61 63 74 69 63 61 6c 00  70 72 61 63 74 69 63 65  |actical.practice|
000037e0  00 70 72 65 63 65 64 65  00 70 72 65 63 65 64 65  |.precede.precede|
000037f0  64 00 70 72 65 63 65 64  65 6e 63 65 00 70 72 65  |d.precedence.pre|
00003800  63 65 64 65 73 00 70 72  65 63 69 73 65 00 70 72  |cedes.precise.pr|
00003810  65 63 69 73 65 6c 79 00  70 72 65 63 69 73 69 6f  |ecisely.precisio|
00003820  6e 00 70 72 65 66 65 72  00 70 72 65 66 65 72 61  |n.prefer.prefera|
00003830  62 6c 65 00 70 72 65 66  65 72 65 6e 63 65 73 00  |ble.preferences.|
00003840  70 72 65 66 65 72 72 65  64 00 70 72 65 66 69 78  |preferred.prefix|
00003850  00 70 72 65 66 69 78 65  64 00 70 72 65 66 69 78  |.prefixed.prefix|
00003860  65 73 00 70 72 65 66 69  78 69 6e 67 00 70 72 65  |es.prefixing.pre|
00003870  6d 69 75 6d 00 70 72 65  70 61 72 65 64 00 70 72  |mium.prepared.pr|
00003880  65 73 65 6e 63 65 00 70  72 65 73 65 6e 74 00 70  |esence.present.p|
00003890  72 65 73 65 6e 74 65 64  00 70 72 65 73 65 6e 74  |resented.present|
000038a0  73 00 70 72 65 73 65 72  76 65 64 00 70 72 65 73  |s.preserved.pres|
000038b0  73 00 70 72 65 73 73 65  64 00 70 72 65 73 73 69  |s.pressed.pressi|
000038c0  6e 67 00 70 72 65 73 75  6d 61 62 6c 79 00 70 72  |ng.presumably.pr|
000038d0  65 76 65 6e 74 00 70 72  65 76 69 6f 75 73 00 70  |event.previous.p|
000038e0  72 65 76 69 6f 75 73 6c  79 00 70 72 69 63 65 00  |reviously.price.|
000038f0  70 72 69 6d 61 72 69 6c  79 00 70 72 69 6d 69 74  |primarily.primit|
00003900  69 76 65 00 70 72 69 6e  63 69 70 6c 65 00 70 72  |ive.principle.pr|
00003910  69 6e 74 00 70 72 69 6e  74 65 64 00 70 72 69 6e  |int.printed.prin|
00003920  74 69 6e 67 00 70 72 69  6e 74 73 00 70 72 69 76  |ting.prints.priv|
00003930  61 63 79 00 70 72 69 76  61 74 65 00 70 72 6f 62  |acy.private.prob|
00003940  61 62 6c 79 00 70 72 6f  62 6c 65 6d 00 70 72 6f  |ably.problem.pro|
00003950  62 6c 65 6d 73 00 70 72  6f 63 65 64 75 72 65 00  |blems.procedure.|
00003960  70 72 6f 63 65 64 75 72  65 73 00 70 72 6f 63 65  |procedures.proce|
00003970  65 64 00 70 72 6f 63 65  65 64 69 6e 67 00 70 72  |ed.proceeding.pr|
00003980  6f 63 65 65 64 73 00 70  72 6f 63 65 73 73 00 70  |oceeds.process.p|
00003990  72 6f 63 65 73 73 65 64  00 70 72 6f 63 65 73 73  |rocessed.process|
000039a0  65 73 00 70 72 6f 63 65  73 73 69 6e 67 00 70 72  |es.processing.pr|
000039b0  6f 63 65 73 73 6f 72 00  70 72 6f 64 75 63 65 00  |ocessor.produce.|
000039c0  70 72 6f 64 75 63 65 64  00 70 72 6f 64 75 63 65  |produced.produce|
000039d0  73 00 70 72 6f 64 75 63  74 00 70 72 6f 64 75 63  |s.product.produc|
000039e0  74 69 6f 6e 00 70 72 6f  66 69 74 00 70 72 6f 67  |tion.profit.prog|
000039f0  72 61 6d 00 70 72 6f 67  72 61 6d 6d 65 72 00 70  |ram.programmer.p|
00003a00  72 6f 67 72 61 6d 6d 65  72 73 00 70 72 6f 67 72  |rogrammers.progr|
00003a10  61 6d 6d 69 6e 67 00 70  72 6f 67 72 61 6d 73 00  |amming.programs.|
00003a20  70 72 6f 67 72 65 73 73  00 70 72 6f 67 72 65 73  |progress.progres|
00003a30  73 69 6f 6e 00 70 72 6f  67 72 65 73 73 69 6f 6e  |sion.progression|
00003a40  73 00 70 72 6f 68 69 62  69 74 00 70 72 6f 6d 6f  |s.prohibit.promo|
00003a50  74 65 64 00 70 72 6f 6d  6f 74 65 73 00 70 72 6f  |ted.promotes.pro|
00003a60  6e 65 00 70 72 6f 70 65  72 00 70 72 6f 70 65 72  |ne.proper.proper|
00003a70  6c 79 00 70 72 6f 70 65  72 74 69 65 73 00 70 72  |ly.properties.pr|
00003a80  6f 74 65 63 74 00 70 72  6f 74 6f 74 79 70 65 73  |otect.prototypes|
00003a90  00 70 72 6f 76 69 64 65  00 70 72 6f 76 69 64 65  |.provide.provide|
00003aa0  64 00 70 72 6f 76 69 64  65 73 00 70 72 6f 76 69  |d.provides.provi|
00003ab0  64 69 6e 67 00 70 75 62  6c 69 63 00 70 75 62 6c  |ding.public.publ|
00003ac0  69 63 69 74 79 00 70 75  62 6c 69 73 68 65 72 00  |icity.publisher.|
00003ad0  70 75 72 65 6c 79 00 70  75 72 70 6f 73 65 00 70  |purely.purpose.p|
00003ae0  75 73 68 00 70 75 73 68  65 64 00 70 75 73 68 65  |ush.pushed.pushe|
00003af0  73 00 70 75 73 68 69 6e  67 00 70 75 74 00 70 75  |s.pushing.put.pu|
00003b00  74 73 00 0e 00 00 00 75  00 00 00 71 75 61 64 72  |ts.....u...quadr|
00003b10  61 74 69 63 61 6c 6c 79  00 71 75 61 6c 69 66 69  |atically.qualifi|
00003b20  65 72 73 00 71 75 61 6c  69 74 79 00 71 75 61 6e  |ers.quality.quan|
00003b30  74 69 74 69 65 73 00 71  75 61 6e 74 69 74 79 00  |tities.quantity.|
00003b40  71 75 65 73 74 69 6f 6e  00 71 75 65 73 74 69 6f  |question.questio|
00003b50  6e 73 00 71 75 69 63 6b  00 71 75 69 63 6b 6c 79  |ns.quick.quickly|
00003b60  00 71 75 69 74 00 71 75  69 74 65 00 71 75 6f 74  |.quit.quite.quot|
00003b70  65 00 71 75 6f 74 65 64  00 71 75 6f 74 65 73 00  |e.quoted.quotes.|
00003b80  9b 00 00 00 6b 05 00 00  72 61 64 69 75 73 00 72  |....k...radius.r|
00003b90  61 69 73 65 00 72 61 6e  64 6f 6d 00 72 61 6e 67  |aise.random.rang|
00003ba0  65 00 72 61 72 65 6c 79  00 72 61 74 68 65 72 00  |e.rarely.rather.|
00003bb0  72 65 61 63 68 65 64 00  72 65 61 63 68 69 6e 67  |reached.reaching|
00003bc0  00 72 65 61 64 00 72 65  61 64 61 62 69 6c 69 74  |.read.readabilit|
00003bd0  79 00 72 65 61 64 61 62  6c 65 00 72 65 61 64 65  |y.readable.reade|
00003be0  72 00 72 65 61 64 65 72  73 00 72 65 61 64 69 6c  |r.readers.readil|
00003bf0  79 00 72 65 61 64 69 6e  67 00 72 65 61 64 73 00  |y.reading.reads.|
00003c00  72 65 61 64 79 00 72 65  61 6c 00 72 65 61 6c 69  |ready.real.reali|
00003c10  74 69 65 73 00 72 65 61  6c 6c 79 00 72 65 61 72  |ties.really.rear|
00003c20  72 61 6e 67 65 00 72 65  61 72 72 61 6e 67 65 64  |range.rearranged|
00003c30  00 72 65 61 73 6f 6e 00  72 65 61 73 6f 6e 61 62  |.reason.reasonab|
00003c40  6c 65 00 72 65 61 73 6f  6e 61 62 6c 79 00 72 65  |le.reasonably.re|
00003c50  61 73 6f 6e 69 6e 67 00  72 65 61 73 6f 6e 73 00  |asoning.reasons.|
00003c60  72 65 63 61 6c 6c 00 72  65 63 65 69 76 65 73 00  |recall.receives.|
00003c70  72 65 63 65 6e 74 6c 79  00 72 65 63 6f 67 6e 69  |recently.recogni|
00003c80  7a 65 00 72 65 63 6f 67  6e 69 7a 65 73 00 72 65  |ze.recognizes.re|
00003c90  63 6f 6d 6d 65 6e 64 00  72 65 63 6f 6d 70 69 6c  |commend.recompil|
00003ca0  65 64 00 72 65 63 6f 72  64 00 72 65 63 6f 72 64  |ed.record.record|
00003cb0  73 00 72 65 63 6f 76 65  72 79 00 72 65 63 74 61  |s.recovery.recta|
00003cc0  6e 67 75 6c 61 72 00 72  65 64 65 66 69 6e 65 64  |ngular.redefined|
00003cd0  00 72 65 64 75 63 65 64  00 72 65 64 75 6e 64 61  |.reduced.redunda|
00003ce0  6e 74 00 72 65 66 65 72  00 72 65 66 65 72 65 6e  |nt.refer.referen|
00003cf0  63 65 00 72 65 66 65 72  65 6e 63 65 64 00 72 65  |ce.referenced.re|
00003d00  66 65 72 65 6e 63 65 73  00 72 65 66 65 72 69 6e  |ferences.referin|
00003d10  67 00 72 65 66 65 72 72  65 64 00 72 65 66 65 72  |g.referred.refer|
00003d20  73 00 72 65 66 6c 65 63  74 00 72 65 66 6c 65 63  |s.reflect.reflec|
00003d30  74 65 64 00 72 65 66 6c  65 63 74 69 6e 67 00 72  |ted.reflecting.r|
00003d40  65 66 6c 65 63 74 73 00  72 65 67 61 72 64 6c 65  |eflects.regardle|
00003d50  73 73 00 72 65 67 69 73  74 65 72 00 72 65 67 69  |ss.register.regi|
00003d60  73 74 65 72 73 00 72 65  67 69 73 74 72 61 74 69  |sters.registrati|
00003d70  6f 6e 00 72 65 67 72 65  74 74 61 62 6c 79 00 72  |on.regrettably.r|
00003d80  65 67 75 6c 61 72 00 72  65 6c 61 74 65 64 00 72  |egular.related.r|
00003d90  65 6c 61 74 69 6f 6e 61  6c 00 72 65 6c 61 74 69  |elational.relati|
00003da0  6f 6e 73 00 72 65 6c 61  74 69 6f 6e 73 68 69 70  |ons.relationship|
00003db0  00 72 65 6c 65 61 73 65  64 00 72 65 6c 65 61 73  |.released.releas|
00003dc0  65 73 00 72 65 6c 65 76  61 6e 74 00 72 65 6c 69  |es.relevant.reli|
00003dd0  65 73 00 72 65 6c 69 67  69 6f 75 73 6c 79 00 72  |es.religiously.r|
00003de0  65 6d 61 69 6e 00 72 65  6d 61 69 6e 64 65 72 00  |emain.remainder.|
00003df0  72 65 6d 61 69 6e 73 00  72 65 6d 61 72 6b 73 00  |remains.remarks.|
00003e00  72 65 6d 65 6d 62 65 72  00 72 65 6d 65 6d 62 65  |remember.remembe|
00003e10  72 69 6e 67 00 72 65 6d  6f 74 65 00 72 65 6d 6f  |ring.remote.remo|
00003e20  76 65 73 00 72 65 6d 6f  76 69 6e 67 00 72 65 6e  |ves.removing.ren|
00003e30  61 6d 65 00 72 65 70 65  61 74 00 72 65 70 65 61  |ame.repeat.repea|
00003e40  74 65 64 00 72 65 70 65  61 74 65 64 6c 79 00 72  |ted.repeatedly.r|
00003e50  65 70 65 61 74 73 00 72  65 70 65 74 69 74 69 6f  |epeats.repetitio|
00003e60  6e 00 72 65 70 6c 61 63  65 00 72 65 70 6c 61 63  |n.replace.replac|
00003e70  65 64 00 72 65 70 6c 61  63 65 6d 65 6e 74 00 72  |ed.replacement.r|
00003e80  65 70 6c 61 63 65 73 00  72 65 70 6c 61 63 69 6e  |eplaces.replacin|
00003e90  67 00 72 65 70 6c 79 00  72 65 70 6f 72 74 00 72  |g.reply.report.r|
00003ea0  65 70 6f 72 74 65 64 00  72 65 70 6f 72 74 69 6e  |eported.reportin|
00003eb0  67 00 72 65 70 6f 73 69  74 69 6f 6e 00 72 65 70  |g.reposition.rep|
00003ec0  6f 73 69 74 69 6f 6e 69  6e 67 00 72 65 70 6f 73  |ositioning.repos|
00003ed0  69 74 69 6f 6e 73 00 72  65 70 72 65 73 65 6e 74  |itions.represent|
00003ee0  00 72 65 70 72 65 73 65  6e 74 61 74 69 6f 6e 00  |.representation.|
00003ef0  72 65 70 72 65 73 65 6e  74 61 74 69 76 65 00 72  |representative.r|
00003f00  65 70 72 65 73 65 6e 74  65 64 00 72 65 70 72 65  |epresented.repre|
00003f10  73 65 6e 74 69 6e 67 00  72 65 70 72 65 73 65 6e  |senting.represen|
00003f20  74 73 00 72 65 71 75 65  73 74 00 72 65 71 75 65  |ts.request.reque|
00003f30  73 74 73 00 72 65 71 75  69 72 65 00 72 65 71 75  |sts.require.requ|
00003f40  69 72 65 64 00 72 65 71  75 69 72 65 6d 65 6e 74  |ired.requirement|
00003f50  00 72 65 71 75 69 72 65  6d 65 6e 74 73 00 72 65  |.requirements.re|
00003f60  71 75 69 72 65 73 00 72  65 71 75 69 72 69 6e 67  |quires.requiring|
00003f70  00 72 65 71 75 69 73 69  74 65 00 72 65 73 65 72  |.requisite.reser|
00003f80  76 65 64 00 72 65 73 65  74 00 72 65 73 65 74 73  |ved.reset.resets|
00003f90  00 72 65 73 69 64 65 00  72 65 73 6f 6c 76 65 64  |.reside.resolved|
00003fa0  00 72 65 73 70 65 63 74  69 76 65 6c 79 00 72 65  |.respectively.re|
00003fb0  73 70 6f 6e 73 69 62 69  6c 69 74 79 00 72 65 73  |sponsibility.res|
00003fc0  70 6f 6e 73 69 62 6c 65  00 72 65 73 74 00 72 65  |ponsible.rest.re|
00003fd0  73 74 72 69 63 74 65 64  00 72 65 73 74 72 69 63  |stricted.restric|
00003fe0  74 69 6f 6e 73 00 72 65  73 75 6c 74 00 72 65 73  |tions.result.res|
00003ff0  75 6c 74 69 6e 67 00 72  65 73 75 6c 74 73 00 72  |ulting.results.r|
00004000  65 73 75 6d 65 00 72 65  73 75 6d 65 73 00 72 65  |esume.resumes.re|
00004010  74 61 69 6e 00 72 65 74  72 69 65 76 65 64 00 72  |tain.retrieved.r|
00004020  65 74 75 72 6e 00 72 65  74 75 72 6e 65 64 00 72  |eturn.returned.r|
00004030  65 74 75 72 6e 69 6e 67  00 72 65 74 75 72 6e 73  |eturning.returns|
00004040  00 72 65 76 65 72 73 65  00 72 65 76 65 72 73 65  |.reverse.reverse|
00004050  73 00 72 65 76 65 72 73  69 6e 67 00 72 65 76 69  |s.reversing.revi|
00004060  73 69 74 00 72 65 77 72  69 74 65 00 72 65 77 72  |sit.rewrite.rewr|
00004070  69 74 69 6e 67 00 72 65  77 72 69 74 74 65 6e 00  |iting.rewritten.|
00004080  72 69 67 68 74 00 72 69  73 6b 79 00 72 6f 62 75  |right.risky.robu|
00004090  73 74 00 72 6f 6f 6d 00  72 6f 6f 74 00 72 6f 75  |st.room.root.rou|
000040a0  6e 64 65 64 00 72 6f 75  6e 64 69 6e 67 00 72 6f  |nded.rounding.ro|
000040b0  75 74 69 6e 65 00 72 6f  75 74 69 6e 65 73 00 72  |utine.routines.r|
000040c0  6f 77 00 72 6f 77 73 00  72 6f 79 61 6c 74 79 00  |ow.rows.royalty.|
000040d0  72 75 64 69 6d 65 6e 74  61 72 79 00 72 75 6c 65  |rudimentary.rule|
000040e0  00 72 75 6c 65 73 00 72  75 6e 00 72 75 6e 6e 69  |.rules.run.runni|
000040f0  6e 67 00 1f 01 00 00 12  09 00 00 73 61 66 65 00  |ng.........safe.|
00004100  73 61 66 65 6c 79 00 73  61 66 65 72 00 73 61 66  |safely.safer.saf|
00004110  65 73 74 00 73 61 69 64  00 73 61 6c 61 72 79 00  |est.said.salary.|
00004120  73 61 6d 65 00 73 61 74  69 73 66 61 63 74 6f 72  |same.satisfactor|
00004130  79 00 73 61 74 69 73 66  69 65 64 00 73 61 74 69  |y.satisfied.sati|
00004140  73 66 79 00 73 61 76 65  00 73 61 76 65 64 00 73  |sfy.save.saved.s|
00004150  61 76 65 73 00 73 61 76  69 6e 67 00 73 61 79 00  |aves.saving.say.|
00004160  73 61 79 69 6e 67 00 73  61 79 73 00 73 63 61 6c  |saying.says.scal|
00004170  65 00 73 63 61 6c 65 64  00 73 63 61 6c 65 73 00  |e.scaled.scales.|
00004180  73 63 61 6c 69 6e 67 00  73 63 61 6e 00 73 63 61  |scaling.scan.sca|
00004190  6e 6e 65 64 00 73 63 61  6e 6e 69 6e 67 00 73 63  |nned.scanning.sc|
000041a0  61 6e 73 00 73 63 69 65  6e 74 69 66 69 63 00 73  |ans.scientific.s|
000041b0  63 6f 70 65 00 73 63 72  61 74 63 68 00 73 63 72  |cope.scratch.scr|
000041c0  65 65 6e 00 73 63 72 6f  6c 6c 00 73 63 72 6f 6c  |een.scroll.scrol|
000041d0  6c 65 64 00 73 65 61 72  63 68 00 73 65 61 72 63  |led.search.searc|
000041e0  68 65 64 00 73 65 61 72  63 68 65 73 00 73 65 61  |hed.searches.sea|
000041f0  72 63 68 69 6e 67 00 73  65 63 6f 6e 64 00 73 65  |rching.second.se|
00004200  63 6f 6e 64 73 00 73 65  63 74 69 6f 6e 00 73 65  |conds.section.se|
00004210  63 74 69 6f 6e 73 00 73  65 63 75 72 69 74 79 00  |ctions.security.|
00004220  73 65 65 00 73 65 65 6d  00 73 65 65 6d 73 00 73  |see.seem.seems.s|
00004230  65 65 6e 00 73 65 6c 65  63 74 00 73 65 6c 65 63  |een.select.selec|
00004240  74 65 64 00 73 65 6c 65  63 74 69 6e 67 00 73 65  |ted.selecting.se|
00004250  6c 66 00 73 65 6c 6c 00  73 65 6c 6c 69 6e 67 00  |lf.sell.selling.|
00004260  73 65 6d 69 63 6f 6c 6f  6e 00 73 65 6d 69 63 6f  |semicolon.semico|
00004270  6c 6f 6e 73 00 73 65 6e  64 00 73 65 6e 64 69 6e  |lons.send.sendin|
00004280  67 00 73 65 6e 73 65 00  73 65 6e 73 69 62 6c 65  |g.sense.sensible|
00004290  00 73 65 6e 74 00 73 65  70 61 72 61 74 65 00 73  |.sent.separate.s|
000042a0  65 70 61 72 61 74 65 64  00 73 65 70 61 72 61 74  |eparated.separat|
000042b0  65 6c 79 00 73 65 70 61  72 61 74 65 73 00 73 65  |ely.separates.se|
000042c0  70 61 72 61 74 6f 72 00  73 65 70 74 65 6d 62 65  |parator.septembe|
000042d0  72 00 73 65 71 75 65 6e  63 65 00 73 65 71 75 65  |r.sequence.seque|
000042e0  6e 63 65 73 00 73 65 72  69 65 73 00 73 65 72 69  |nces.series.seri|
000042f0  6f 75 73 00 73 65 72 69  6f 75 73 6c 79 00 73 65  |ous.seriously.se|
00004300  72 76 65 00 73 65 72 76  65 72 73 00 73 65 72 76  |rve.servers.serv|
00004310  65 73 00 73 65 72 76 69  63 65 00 73 65 74 00 73  |es.service.set.s|
00004320  65 74 73 00 73 65 74 74  69 6e 67 00 73 65 74 74  |ets.setting.sett|
00004330  69 6e 67 73 00 73 65 76  65 72 61 6c 00 73 68 61  |ings.several.sha|
00004340  6c 6c 00 73 68 61 70 65  00 73 68 61 72 65 00 73  |ll.shape.share.s|
00004350  68 61 72 65 64 00 73 68  65 6c 6c 00 73 68 69 66  |hared.shell.shif|
00004360  74 00 73 68 69 66 74 65  64 00 73 68 69 66 74 69  |t.shifted.shifti|
00004370  6e 67 00 73 68 69 66 74  73 00 73 68 6f 65 00 73  |ng.shifts.shoe.s|
00004380  68 6f 72 74 00 73 68 6f  72 74 65 72 00 73 68 6f  |hort.shorter.sho|
00004390  72 74 6c 79 00 73 68 6f  75 6c 64 00 73 68 6f 77  |rtly.should.show|
000043a0  00 73 68 6f 77 65 64 00  73 68 6f 77 6e 00 73 68  |.showed.shown.sh|
000043b0  6f 77 73 00 73 68 72 69  6e 6b 69 6e 67 00 73 68  |ows.shrinking.sh|
000043c0  72 69 6e 6b 73 00 73 69  64 65 00 73 69 64 65 73  |rinks.side.sides|
000043d0  00 73 69 67 68 74 00 73  69 67 6e 00 73 69 67 6e  |.sight.sign.sign|
000043e0  61 6c 00 73 69 67 6e 61  6c 73 00 73 69 67 6e 65  |al.signals.signe|
000043f0  64 00 73 69 67 6e 69 66  69 63 61 6e 74 00 73 69  |d.significant.si|
00004400  67 6e 69 66 69 63 61 6e  74 6c 79 00 73 69 6d 69  |gnificantly.simi|
00004410  6c 61 72 00 73 69 6d 69  6c 61 72 6c 79 00 73 69  |lar.similarly.si|
00004420  6d 70 6c 65 00 73 69 6d  70 6c 65 72 00 73 69 6d  |mple.simpler.sim|
00004430  70 6c 65 73 74 00 73 69  6d 70 6c 69 63 69 74 79  |plest.simplicity|
00004440  00 73 69 6d 70 6c 69 66  79 00 73 69 6d 70 6c 79  |.simplify.simply|
00004450  00 73 69 6d 75 6c 61 74  65 00 73 69 6d 75 6c 61  |.simulate.simula|
00004460  74 69 6f 6e 00 73 69 6d  75 6c 74 61 6e 65 6f 75  |tion.simultaneou|
00004470  73 6c 79 00 73 69 6e 63  65 00 73 69 6e 67 6c 65  |sly.since.single|
00004480  00 73 69 74 65 73 00 73  69 74 75 61 74 69 6f 6e  |.sites.situation|
00004490  00 73 69 74 75 61 74 69  6f 6e 73 00 73 69 78 00  |.situations.six.|
000044a0  73 69 7a 65 00 73 69 7a  65 64 00 73 69 7a 65 73  |size.sized.sizes|
000044b0  00 73 6b 69 70 00 73 6b  69 70 70 65 64 00 73 6c  |.skip.skipped.sl|
000044c0  69 67 68 74 6c 79 00 73  6c 6f 77 00 73 6d 61 6c  |ightly.slow.smal|
000044d0  6c 00 73 6d 61 6c 6c 65  72 00 73 6f 00 73 6f 63  |l.smaller.so.soc|
000044e0  69 61 6c 00 73 6f 66 74  77 61 72 65 00 73 6f 6c  |ial.software.sol|
000044f0  64 00 73 6f 6c 75 74 69  6f 6e 00 73 6f 6c 75 74  |d.solution.solut|
00004500  69 6f 6e 73 00 73 6f 6c  76 65 00 73 6f 6c 76 65  |ions.solve.solve|
00004510  64 00 73 6f 6d 65 00 73  6f 6d 65 68 6f 77 00 73  |d.some.somehow.s|
00004520  6f 6d 65 6f 6e 65 00 73  6f 6d 65 74 68 69 6e 67  |omeone.something|
00004530  00 73 6f 6d 65 74 69 6d  65 73 00 73 6f 6d 65 77  |.sometimes.somew|
00004540  68 61 74 00 73 6f 6d 65  77 68 65 72 65 00 73 6f  |hat.somewhere.so|
00004550  6f 6e 00 73 6f 70 68 69  73 74 69 63 61 74 65 64  |on.sophisticated|
00004560  00 73 6f 72 74 00 73 6f  72 74 65 64 00 73 6f 72  |.sort.sorted.sor|
00004570  74 69 6e 67 00 73 6f 72  74 73 00 73 6f 75 6e 64  |ting.sorts.sound|
00004580  73 00 73 6f 75 72 63 65  00 73 70 61 63 65 00 73  |s.source.space.s|
00004590  70 61 63 65 73 00 73 70  61 72 69 6e 67 6c 79 00  |paces.sparingly.|
000045a0  73 70 61 72 6b 00 73 70  65 63 69 61 6c 00 73 70  |spark.special.sp|
000045b0  65 63 69 61 6c 69 7a 65  64 00 73 70 65 63 69 66  |ecialized.specif|
000045c0  69 63 00 73 70 65 63 69  66 69 63 61 6c 6c 79 00  |ic.specifically.|
000045d0  73 70 65 63 69 66 69 63  61 74 69 6f 6e 00 73 70  |specification.sp|
000045e0  65 63 69 66 69 65 64 00  73 70 65 63 69 66 69 65  |ecified.specifie|
000045f0  73 00 73 70 65 63 69 66  79 00 73 70 65 65 64 73  |s.specify.speeds|
00004600  00 73 70 65 6c 74 00 73  70 69 74 65 00 73 70 6c  |.spelt.spite.spl|
00004610  69 74 00 73 70 72 69 74  65 00 73 70 72 69 74 65  |it.sprite.sprite|
00004620  73 00 73 71 75 61 72 65  00 73 71 75 61 73 68 65  |s.square.squashe|
00004630  64 00 73 71 75 65 65 7a  65 00 73 74 61 63 6b 00  |d.squeeze.stack.|
00004640  73 74 61 67 65 00 73 74  61 67 65 73 00 73 74 61  |stage.stages.sta|
00004650  6d 70 65 64 00 73 74 61  6e 64 61 72 64 00 73 74  |mped.standard.st|
00004660  61 6e 64 73 00 73 74 61  72 74 00 73 74 61 72 74  |ands.start.start|
00004670  65 64 00 73 74 61 72 74  69 6e 67 00 73 74 61 72  |ed.starting.star|
00004680  74 73 00 73 74 61 74 65  00 73 74 61 74 65 64 00  |ts.state.stated.|
00004690  73 74 61 74 65 6d 65 6e  74 00 73 74 61 74 65 6d  |statement.statem|
000046a0  65 6e 74 73 00 73 74 61  74 65 73 00 73 74 61 74  |ents.states.stat|
000046b0  69 63 00 73 74 61 74 75  73 00 73 74 65 61 6c 69  |ic.status.steali|
000046c0  6e 67 00 73 74 65 70 00  73 74 65 70 73 00 73 74  |ng.step.steps.st|
000046d0  69 63 6b 00 73 74 69 63  6b 79 00 73 74 69 6c 6c  |ick.sticky.still|
000046e0  00 73 74 69 6e 67 00 73  74 6f 70 00 73 74 6f 70  |.sting.stop.stop|
000046f0  70 65 64 00 73 74 6f 70  73 00 73 74 6f 72 61 67  |ped.stops.storag|
00004700  65 00 73 74 6f 72 65 00  73 74 6f 72 65 64 00 73  |e.store.stored.s|
00004710  74 6f 72 65 73 00 73 74  6f 72 69 6e 67 00 73 74  |tores.storing.st|
00004720  72 61 69 67 68 74 00 73  74 72 61 69 67 68 74 66  |raight.straightf|
00004730  6f 72 77 61 72 64 00 73  74 72 61 69 67 68 74 66  |orward.straightf|
00004740  6f 72 77 61 72 64 6c 79  00 73 74 72 65 61 6d 00  |orwardly.stream.|
00004750  73 74 72 65 6e 67 74 68  73 00 73 74 72 69 6e 67  |strengths.string|
00004760  00 73 74 72 69 6e 67 73  00 73 74 72 6f 6e 67 00  |.strings.strong.|
00004770  73 74 72 6f 6e 67 6c 79  00 73 74 72 75 63 74 75  |strongly.structu|
00004780  72 65 00 73 74 72 75 63  74 75 72 65 64 00 73 74  |re.structured.st|
00004790  72 75 63 74 75 72 65 73  00 73 74 75 64 69 65 64  |ructures.studied|
000047a0  00 73 74 75 64 79 00 73  74 75 64 79 69 6e 67 00  |.study.studying.|
000047b0  73 74 79 6c 65 00 73 74  79 6c 65 73 00 73 75 62  |style.styles.sub|
000047c0  00 73 75 62 6a 65 63 74  00 73 75 62 72 6f 75 74  |.subject.subrout|
000047d0  69 6e 65 00 73 75 62 73  63 72 69 70 74 00 73 75  |ine.subscript.su|
000047e0  62 73 63 72 69 70 74 69  6e 67 00 73 75 62 73 63  |bscripting.subsc|
000047f0  72 69 70 74 73 00 73 75  62 73 65 71 75 65 6e 74  |ripts.subsequent|
00004800  00 73 75 62 73 65 71 75  65 6e 74 6c 79 00 73 75  |.subsequently.su|
00004810  62 73 74 61 6e 74 69 61  6c 6c 79 00 73 75 62 73  |bstantially.subs|
00004820  74 69 74 75 74 65 64 00  73 75 62 73 74 69 74 75  |tituted.substitu|
00004830  74 69 6f 6e 00 73 75 62  73 74 69 74 75 74 69 6f  |tion.substitutio|
00004840  6e 73 00 73 75 62 74 6c  65 00 73 75 62 74 72 61  |ns.subtle.subtra|
00004850  63 74 00 73 75 62 74 72  61 63 74 65 64 00 73 75  |ct.subtracted.su|
00004860  62 74 72 61 63 74 69 6e  67 00 73 75 62 74 72 61  |btracting.subtra|
00004870  63 74 69 6f 6e 00 73 75  62 74 72 61 63 74 73 00  |ction.subtracts.|
00004880  73 75 63 63 65 73 73 66  75 6c 6c 79 00 73 75 63  |successfully.suc|
00004890  63 65 73 73 69 76 65 00  73 75 63 68 00 73 75 66  |cessive.such.suf|
000048a0  66 65 72 00 73 75 66 66  69 63 65 73 00 73 75 66  |fer.suffices.suf|
000048b0  66 69 63 69 65 6e 74 00  73 75 67 67 65 73 74 00  |ficient.suggest.|
000048c0  73 75 67 67 65 73 74 65  64 00 73 75 67 67 65 73  |suggested.sugges|
000048d0  74 69 6f 6e 73 00 73 75  67 67 65 73 74 73 00 73  |tions.suggests.s|
000048e0  75 69 74 61 62 6c 65 00  73 75 6d 00 73 75 6d 6d  |uitable.sum.summ|
000048f0  61 72 69 7a 65 64 00 73  75 6d 6d 61 72 69 7a 65  |arized.summarize|
00004900  73 00 73 75 70 65 72 69  6f 72 00 73 75 70 65 72  |s.superior.super|
00004910  73 65 64 65 00 73 75 70  70 6c 69 65 64 00 73 75  |sede.supplied.su|
00004920  70 70 6c 69 65 73 00 73  75 70 70 6c 79 00 73 75  |pplies.supply.su|
00004930  70 70 6c 79 69 6e 67 00  73 75 70 70 6f 72 74 00  |pplying.support.|
00004940  73 75 70 70 6f 72 74 69  6e 67 00 73 75 70 70 6f  |supporting.suppo|
00004950  72 74 73 00 73 75 70 70  6f 73 65 00 73 75 70 70  |rts.suppose.supp|
00004960  72 65 73 73 65 73 00 73  75 70 72 69 73 69 6e 67  |resses.suprising|
00004970  00 73 75 70 72 69 73 69  6e 67 6c 79 00 73 75 72  |.suprisingly.sur|
00004980  65 00 73 75 72 72 6f 75  6e 64 00 73 75 72 72 6f  |e.surround.surro|
00004990  75 6e 64 65 64 00 73 75  73 74 61 69 6e 65 64 00  |unded.sustained.|
000049a0  73 77 61 70 00 73 77 61  70 70 69 6e 67 00 73 77  |swap.swapping.sw|
000049b0  69 74 63 68 00 73 77 69  74 63 68 65 64 00 73 79  |itch.switched.sy|
000049c0  6d 62 6f 6c 00 73 79 6d  62 6f 6c 69 63 00 73 79  |mbol.symbolic.sy|
000049d0  6d 62 6f 6c 73 00 73 79  6e 6f 6e 79 6d 00 73 79  |mbols.synonym.sy|
000049e0  6e 74 61 63 74 69 63 61  6c 6c 79 00 73 79 6e 74  |ntactically.synt|
000049f0  61 78 00 73 79 73 74 65  6d 00 73 79 73 74 65 6d  |ax.system.system|
00004a00  61 74 69 63 00 73 79 73  74 65 6d 73 00 7b 00 00  |atic.systems.{..|
00004a10  00 74 03 00 00 74 61 62  00 74 61 62 6c 65 00 74  |.t...tab.table.t|
00004a20  61 62 6c 65 73 00 74 61  62 73 00 74 61 67 00 74  |ables.tabs.tag.t|
00004a30  61 67 67 65 64 00 74 61  6b 65 00 74 61 6b 65 6e  |agged.take.taken|
00004a40  00 74 61 6b 65 73 00 74  61 6b 69 6e 67 00 74 61  |.takes.taking.ta|
00004a50  6c 6b 00 74 61 72 67 65  74 00 74 61 73 6b 00 74  |lk.target.task.t|
00004a60  61 73 6b 73 00 74 61 73  74 65 00 74 65 63 68 6e  |asks.taste.techn|
00004a70  69 63 61 6c 6c 79 00 74  65 6c 6c 00 74 65 6c 6c  |ically.tell.tell|
00004a80  73 00 74 65 6d 70 65 72  61 74 75 72 65 00 74 65  |s.temperature.te|
00004a90  6d 70 65 72 61 74 75 72  65 73 00 74 65 6d 70 6c  |mperatures.templ|
00004aa0  61 74 65 00 74 65 6d 70  6c 61 74 65 73 00 74 65  |ate.templates.te|
00004ab0  6d 70 6f 72 61 72 69 6c  79 00 74 65 6d 70 6f 72  |mporarily.tempor|
00004ac0  61 72 79 00 74 65 6e 00  74 65 6e 64 00 74 65 6e  |ary.ten.tend.ten|
00004ad0  64 61 6e 63 79 00 74 65  6e 64 65 6e 63 79 00 74  |dancy.tendency.t|
00004ae0  65 6e 64 73 00 74 65 6e  74 68 00 74 65 6e 74 68  |ends.tenth.tenth|
00004af0  73 00 74 65 72 6d 00 74  65 72 6d 69 6e 61 6c 00  |s.term.terminal.|
00004b00  74 65 72 6d 69 6e 61 74  65 00 74 65 72 6d 69 6e  |terminate.termin|
00004b10  61 74 65 64 00 74 65 72  6d 69 6e 61 74 65 73 00  |ated.terminates.|
00004b20  74 65 72 6d 69 6e 61 74  69 6e 67 00 74 65 72 6d  |terminating.term|
00004b30  69 6e 61 74 69 6f 6e 00  74 65 72 6d 69 6e 6f 6c  |ination.terminol|
00004b40  6f 67 79 00 74 65 72 6d  73 00 74 65 73 74 00 74  |ogy.terms.test.t|
00004b50  65 73 74 65 64 00 74 65  73 74 69 6e 67 00 74 65  |ested.testing.te|
00004b60  73 74 73 00 74 65 78 74  00 74 65 78 74 73 00 74  |sts.text.texts.t|
00004b70  65 78 74 75 61 6c 00 74  68 61 6e 00 74 68 61 6e  |extual.than.than|
00004b80  6b 73 00 74 68 61 74 00  74 68 65 00 74 68 65 69  |ks.that.the.thei|
00004b90  72 00 74 68 65 6d 00 74  68 65 6d 73 65 6c 76 65  |r.them.themselve|
00004ba0  73 00 74 68 65 6e 00 74  68 65 72 65 00 74 68 65  |s.then.there.the|
00004bb0  72 65 61 66 74 65 72 00  74 68 65 72 65 66 6f 72  |reafter.therefor|
00004bc0  65 00 74 68 65 73 65 00  74 68 65 79 00 74 68 69  |e.these.they.thi|
00004bd0  63 6b 6e 65 73 73 00 74  68 69 6e 67 00 74 68 69  |ckness.thing.thi|
00004be0  6e 67 73 00 74 68 69 6e  6b 00 74 68 69 72 64 00  |ngs.think.third.|
00004bf0  74 68 69 73 00 74 68 6f  73 65 00 74 68 6f 75 67  |this.those.thoug|
00004c00  68 00 74 68 6f 75 67 68  74 00 74 68 72 65 65 00  |h.thought.three.|
00004c10  74 68 72 6f 75 67 68 00  74 68 72 6f 75 67 68 6f  |through.througho|
00004c20  75 74 00 74 68 75 73 00  74 69 65 00 74 69 67 68  |ut.thus.tie.tigh|
00004c30  74 6c 79 00 74 69 6d 65  00 74 69 6d 65 73 00 74  |tly.time.times.t|
00004c40  69 6e 79 00 74 69 74 6c  65 00 74 6f 00 74 6f 67  |iny.title.to.tog|
00004c50  65 74 68 65 72 00 74 6f  6b 65 6e 00 74 6f 6f 00  |ether.token.too.|
00004c60  74 6f 6f 6b 00 74 6f 70  00 74 6f 70 69 63 00 74  |took.top.topic.t|
00004c70  6f 77 61 72 64 00 74 72  61 63 6b 00 74 72 61 64  |oward.track.trad|
00004c80  69 74 69 6f 6e 61 6c 00  74 72 61 69 6c 00 74 72  |itional.trail.tr|
00004c90  61 69 6c 69 6e 67 00 74  72 61 6e 73 66 65 72 73  |ailing.transfers|
00004ca0  00 74 72 61 6e 73 66 6f  72 6d 61 74 69 6f 6e 73  |.transformations|
00004cb0  00 74 72 61 6e 73 6c 61  74 69 6e 67 00 74 72 65  |.translating.tre|
00004cc0  61 74 00 74 72 65 61 74  65 64 00 74 72 65 61 74  |at.treated.treat|
00004cd0  73 00 74 72 65 65 00 74  72 65 65 73 00 74 72 69  |s.tree.trees.tri|
00004ce0  63 6b 79 00 74 72 69 76  69 61 6c 00 74 72 6f 75  |cky.trivial.trou|
00004cf0  62 6c 65 00 74 72 75 65  00 74 72 75 6c 79 00 74  |ble.true.truly.t|
00004d00  72 75 6e 63 61 74 65 73  00 74 72 75 6e 63 61 74  |runcates.truncat|
00004d10  69 6f 6e 00 74 72 75 74  68 00 74 72 79 00 74 75  |ion.truth.try.tu|
00004d20  72 6e 00 74 75 72 6e 73  00 74 75 72 74 6c 65 00  |rn.turns.turtle.|
00004d30  74 77 65 6c 76 65 00 74  77 65 6e 74 79 00 74 77  |twelve.twenty.tw|
00004d40  69 63 65 00 74 77 69 6e  00 74 77 6f 00 74 79 70  |ice.twin.two.typ|
00004d50  65 00 74 79 70 65 64 00  74 79 70 65 73 00 74 79  |e.typed.types.ty|
00004d60  70 69 63 61 6c 00 74 79  70 69 63 61 6c 6c 79 00  |pical.typically.|
00004d70  74 79 70 69 66 69 65 64  00 74 79 70 6f 67 72 61  |typified.typogra|
00004d80  70 68 69 63 61 6c 6c 79  00 39 00 00 00 e2 01 00  |phically.9......|
00004d90  00 75 6c 74 69 6d 61 74  65 00 75 6e 62 61 6c 61  |.ultimate.unbala|
00004da0  6e 63 65 64 00 75 6e 63  68 61 6e 67 65 64 00 75  |nced.unchanged.u|
00004db0  6e 64 65 66 69 6e 65 64  00 75 6e 64 65 72 00 75  |ndefined.under.u|
00004dc0  6e 64 65 72 6e 65 61 74  68 00 75 6e 64 65 72 73  |nderneath.unders|
00004dd0  74 61 6e 64 00 75 6e 64  65 73 69 72 65 64 00 75  |tand.undesired.u|
00004de0  6e 65 71 75 69 76 6f 63  61 6c 6c 79 00 75 6e 65  |nequivocally.une|
00004df0  78 70 65 63 74 65 64 00  75 6e 66 61 6d 69 6c 69  |xpected.unfamili|
00004e00  61 72 00 75 6e 66 6f 72  74 75 6e 61 74 65 00 75  |ar.unfortunate.u|
00004e10  6e 66 6f 72 74 75 6e 61  74 65 6c 79 00 75 6e 66  |nfortunately.unf|
00004e20  72 69 65 6e 64 6c 79 00  75 6e 68 61 70 70 79 00  |riendly.unhappy.|
00004e30  75 6e 69 6e 69 74 69 61  74 65 64 00 75 6e 69 6f  |uninitiated.unio|
00004e40  6e 00 75 6e 69 6f 6e 73  00 75 6e 69 74 00 75 6e  |n.unions.unit.un|
00004e50  69 74 73 00 75 6e 69 76  65 72 73 61 6c 6c 79 00  |its.universally.|
00004e60  75 6e 6b 6e 6f 77 6e 00  75 6e 6c 65 73 73 00 75  |unknown.unless.u|
00004e70  6e 6c 69 6b 65 00 75 6e  6c 69 6b 65 6c 79 00 75  |nlike.unlikely.u|
00004e80  6e 6c 75 63 6b 79 00 75  6e 6e 61 6d 65 64 00 75  |nlucky.unnamed.u|
00004e90  6e 6e 65 63 65 73 73 61  72 79 00 75 6e 70 72 65  |nnecessary.unpre|
00004ea0  64 69 63 74 61 62 6c 65  00 75 6e 71 75 6f 74 65  |dictable.unquote|
00004eb0  64 00 75 6e 72 65 6c 61  74 65 64 00 75 6e 73 61  |d.unrelated.unsa|
00004ec0  74 69 73 66 61 63 74 6f  72 79 00 75 6e 73 69 67  |tisfactory.unsig|
00004ed0  6e 65 64 00 75 6e 73 70  65 63 69 66 69 65 64 00  |ned.unspecified.|
00004ee0  75 6e 74 69 6c 00 75 6e  75 73 75 61 6c 00 75 6e  |until.unusual.un|
00004ef0  77 61 6e 74 65 64 00 75  6e 77 69 73 65 6c 79 00  |wanted.unwisely.|
00004f00  75 70 00 75 70 64 61 74  65 64 00 75 70 67 72 61  |up.updated.upgra|
00004f10  64 65 73 00 75 70 6f 6e  00 75 70 70 65 72 00 75  |des.upon.upper.u|
00004f20  70 77 61 72 64 00 75 70  77 61 72 64 73 00 75 73  |pward.upwards.us|
00004f30  00 75 73 61 67 65 00 75  73 65 00 75 73 65 64 00  |.usage.use.used.|
00004f40  75 73 65 66 75 6c 00 75  73 65 72 00 75 73 65 72  |useful.user.user|
00004f50  73 00 75 73 65 73 00 75  73 69 6e 67 00 75 73 75  |s.uses.using.usu|
00004f60  61 6c 00 75 73 75 61 6c  6c 79 00 75 74 69 6c 69  |al.usually.utili|
00004f70  74 79 00 19 00 00 00 b8  00 00 00 76 61 63 61 74  |ty.........vacat|
00004f80  65 64 00 76 61 6c 69 64  00 76 61 6c 75 61 62 6c  |ed.valid.valuabl|
00004f90  65 00 76 61 6c 75 65 00  76 61 6c 75 65 73 00 76  |e.value.values.v|
00004fa0  61 72 69 61 62 6c 65 00  76 61 72 69 61 62 6c 65  |ariable.variable|
00004fb0  73 00 76 61 72 69 61 74  69 6f 6e 00 76 61 72 69  |s.variation.vari|
00004fc0  61 74 69 6f 6e 73 00 76  61 72 69 65 73 00 76 61  |ations.varies.va|
00004fd0  72 69 6f 75 73 00 76 61  72 79 00 76 65 63 74 6f  |rious.vary.vecto|
00004fe0  72 00 76 65 72 69 66 79  00 76 65 72 73 69 6f 6e  |r.verify.version|
00004ff0  00 76 65 72 73 69 6f 6e  73 00 76 65 72 73 75 73  |.versions.versus|
00005000  00 76 65 72 79 00 76 65  78 69 6e 67 00 76 69 61  |.very.vexing.via|
00005010  00 76 69 63 65 00 76 69  65 77 65 72 00 76 69 65  |.vice.viewer.vie|
00005020  77 69 6e 67 00 76 69 65  77 73 00 76 69 73 69 62  |wing.views.visib|
00005030  6c 65 00 41 00 00 00 9c  01 00 00 77 61 69 74 69  |le.A.......waiti|
00005040  6e 67 00 77 61 69 74 73  00 77 61 6c 6b 00 77 61  |ng.waits.walk.wa|
00005050  6e 74 00 77 61 6e 74 65  64 00 77 61 6e 74 73 00  |nt.wanted.wants.|
00005060  77 61 72 6e 69 6e 67 00  77 61 73 00 77 61 73 74  |warning.was.wast|
00005070  65 64 00 77 61 79 00 77  61 79 73 00 77 65 00 77  |ed.way.ways.we.w|
00005080  65 6c 63 6f 6d 65 00 77  65 6c 6c 00 77 65 6e 74  |elcome.well.went|
00005090  00 77 65 72 65 00 77 68  61 74 00 77 68 61 74 65  |.were.what.whate|
000050a0  76 65 72 00 77 68 65 6e  00 77 68 65 72 65 00 77  |ver.when.where.w|
000050b0  68 65 74 68 65 72 00 77  68 69 63 68 00 77 68 69  |hether.which.whi|
000050c0  63 68 65 76 65 72 00 77  68 69 6c 65 00 77 68 69  |chever.while.whi|
000050d0  6c 73 74 00 77 68 69 74  65 00 77 68 6f 00 77 68  |lst.white.who.wh|
000050e0  6f 6c 65 00 77 68 6f 73  65 00 77 68 79 00 77 69  |ole.whose.why.wi|
000050f0  64 65 00 77 69 64 65 73  74 00 77 69 64 74 68 00  |de.widest.width.|
00005100  77 69 6c 6c 00 77 69 6e  64 6f 77 00 77 69 6e 64  |will.window.wind|
00005110  6f 77 73 00 77 69 70 65  73 00 77 69 72 65 64 00  |ows.wipes.wired.|
00005120  77 69 72 69 6e 67 00 77  69 73 65 00 77 69 73 65  |wiring.wise.wise|
00005130  72 00 77 69 73 68 65 73  00 77 69 74 68 00 77 69  |r.wishes.with.wi|
00005140  74 68 69 6e 00 77 69 74  68 6f 75 74 00 77 6f 6e  |thin.without.won|
00005150  64 65 72 00 77 6f 72 64  00 77 6f 72 64 73 00 77  |der.word.words.w|
00005160  6f 72 6b 00 77 6f 72 6b  69 6e 67 00 77 6f 72 6b  |ork.working.work|
00005170  73 00 77 6f 72 6c 64 00  77 6f 72 72 79 00 77 6f  |s.world.worry.wo|
00005180  72 72 79 69 6e 67 00 77  6f 72 73 74 00 77 6f 72  |rrying.worst.wor|
00005190  74 68 00 77 6f 72 74 68  77 68 69 6c 65 00 77 6f  |th.worthwhile.wo|
000051a0  72 74 68 79 00 77 6f 75  6c 64 00 77 72 69 74 65  |rthy.would.write|
000051b0  00 77 72 69 74 65 61 62  6c 65 00 77 72 69 74 69  |.writeable.writi|
000051c0  6e 67 00 77 72 69 74 74  65 6e 00 77 72 6f 6e 67  |ng.written.wrong|
000051d0  00 77 72 6f 74 65 00 00  00 00 00 00 00 00 00 08  |.wrote..........|
000051e0  00 00 00 2c 00 00 00 79  65 61 72 00 79 65 61 72  |...,...year.year|
000051f0  73 00 79 65 73 00 79 65  74 00 79 69 65 6c 64 73  |s.yes.yet.yields|
00005200  00 79 6f 75 00 79 6f 75  72 00 79 6f 75 72 73 65  |.you.your.yourse|
00005210  6c 66 00 03 00 00 00 13  00 00 00 7a 65 72 6f 00  |lf.........zero.|
00005220  7a 65 72 6f 73 00 7a 6f  6f 6d 69 6e 67 00        |zeros.zooming.|
0000522e